SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013027 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013027
Domain Number 1 Region: 368-588
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-53
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 898-1145
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000298
Family WD40-repeat 0.038
Further Details:      
 
Domain Number 3 Region: 601-676,770-825
Classification Level Classification E-value
Superfamily PH domain-like 0.000000132
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013027   Gene: ENSOGAG00000014534   Transcript: ENSOGAT00000014544
Sequence length 1329
Comment pep:known_by_projection scaffold:OtoGar3:GL873633.1:4350303:4436127:-1 gene:ENSOGAG00000014534 transcript:ENSOGAT00000014544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESEVKCDTNNNEEDEGEQFDFDSGDEIPEADREAASAPEGLEAAGEGSLPTGGEDGRGAD
SITAAEPPKLVAPVKVNPYSVIDITPFQEDPPPTADCGAEEEGVGLLVPSGYSVPVPCGY
AVPSSLPLLLPAYSSPVIVRTTSLDEEAETLEVTEDHQFNSLSSEDPANSEDQVNKEDSA
LARWVADPANTAWMENPEEAIYDDVPRENSDSEPDEMIYDDVENGEEGGNSSLEYGWSSS
EFESYEEQSDSECRNGVPRSFLRSSHKKQLSHDLSRLKEHYERKMRGLVASTVGAVEVQQ
LRQKHELKMQKLMKAAREGTKDGLEKTKAAVKRGRSYIRTKSLISQDHRACPEEEQNLFI
DVDCKHPEAVLTPMPEGLSQQQVVRRCILGAVVDSEKNYVDALKRILEHYEKPLSEMEPK
VLSERKLKVVFHRVKEILQCHSMFQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSE
YVNNFSTAVAVLKKTCATKPAFLEFLKQRQEASPDRVTLYSLMTRPVQRFPQFILLLQDM
LKNTPRGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKQIAKAINEKYLNKLLSSG
NRYLIRSDDMIETVYNDRGEITKTKERRVFMLNDVLMCATVSSRTLHESNAITSQRYLLK
WSVPLGHVEVIEYGNNQGTGEHGRYPIVHAPESLAVVANVKPHKVYMGPGQLYQDLQNLL
HDLNVIGQISQLIGNLKGNYQNLNQSVAHDWTSGLQRLILKKEEEIRAADCCRIQLQLPG
KQDKSGRPTFFTAVFNTFTPAIKESWTSSLQMAKLALEEENHLGWFCVEDDGNQIKKEKH
PLLVGHMPVMVAKQQEFKIECAAYNPEPCLSNETQPDSFSAVHGFLWIGSCTHQMGQIAI
VSFQNSNPKVIECFNVESRILSMVHIPAEEKHREPSTAPEPAAASSGRAGDTPTVCVGAE
EGSISVYKSSQGSKKVRLQHFFTPERSTVMSLAGSPRSLYAGLVDGAVASYARAEDGSWN
SEPQKVVKLGVLPVRSLLMMEDTLWAASGGQVFVISLETHAVENQLEAHHEEGMVISHMA
VAGVGIWIAFTSGSTLRLFHTETLEHLQDVNIAAPVHSLLPGHQRLSVTSLLVGHGLLMV
GTSLGVLVALPVPRLQGIPKVTGRGMVSYHAHNGPVKFIILATALQEKDKDRSGDNMALG
PEALEDDQKDGLPSEGAGSRLSQGDPDTAIWLGDAPGSLTQKSDMSSSSGSLSLSQGSSS
QEHRLEDSAIYDLLKDPMSLRSRGRRAKKVRASSALVVCGGQGHRRVPRRARQSHPEELV
ASVMVWQVP
Download sequence
Identical sequences H0XBF2
ENSOGAP00000013027 ENSOGAP00000013027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]