SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013041 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013041
Domain Number 1 Region: 68-306
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000126
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 421-597,625-693
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000173
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013041   Gene: ENSOGAG00000014554   Transcript: ENSOGAT00000014560
Sequence length 745
Comment pep:known_by_projection scaffold:OtoGar3:GL873653.1:1601130:1632288:-1 gene:ENSOGAG00000014554 transcript:ENSOGAT00000014560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFNHDLPVRGRPRDPTQLPNVFSWPIGAAAKQSICIDQAVVFIEDAIQYRSINHRMDPRS
VWLYRWYYSDICQWTLSFTIFVILVLAFIEIPSSLSKTSDVRHRSLPWEPPCGLTESVEV
LCLLVFVTDLTVKGYLFGWVHFKKNHWMVVYVGVLFVSLVDWIVSVSLHCQAPLRVRRVL
RPFFLLQNSSMMKKTLKGIRWSLPQMASVGLLLAVHLLLFTMFGMLLFAGEKDDWQRRER
QTYFRNLPDALTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFSIIEGSLFLMNLLTAI
IYSKFRGYLMKSLQTSLLRRRLGTRAAFEVLSSLSKVAEASSQEVRVQPQYLLLVLQKVQ
VDSFHKQALMEKVRSFQNAPLSANEFQRLFNELDKSVVKEHPPRPQYQSPFLQNAQFYFG
HHYFDYLGNLVALGNLVSICVFLLLDADRLPGDHVSHFILGSLDFVFILYYLLEMLLKIF
ALGLWGYLSYPSNLFDGFLTTALLLKVLEISTLAVYRFPHPGWWPQMQGLLSLWDMARML
NMLIVCRFLRIIPNIKPVAMVAGTALSLIQNMRAFGGIVVVVYYVFAIVGISLFRGVIVA
PSVNSSLAAVNESVPCGSYEQLEYWANNFDDFAAALVTLWNVMMVNNWQVFLDAYQRYSG
QWSKIYFISWWLLSSVIWINLLLALILENFLHKWDSQSDLHPLDGTEEATYQMTEELPFR
DILEEPKEEELLEKLRRHLHLHLCR
Download sequence
Identical sequences H0XBG2
ENSOGAP00000013041 ENSOGAP00000013041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]