SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013100 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013100
Domain Number 1 Region: 302-517
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-51
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 819-1119
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000022
Family WD40-repeat 0.023
Further Details:      
 
Domain Number 3 Region: 530-613,707-765
Classification Level Classification E-value
Superfamily PH domain-like 0.000000076
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013100   Gene: ENSOGAG00000014616   Transcript: ENSOGAT00000014626
Sequence length 1279
Comment pep:known_by_projection scaffold:OtoGar3:GL873528.1:6992703:7093992:-1 gene:ENSOGAG00000014616 transcript:ENSOGAT00000014626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSNPPPQPAIGDQLVPGVPGPSPEPEDDPGEAFEFDDSDDEEDTSVGLGIPSFPSEKD
TDPPLIDLDSTPIPDPDSAAEPPSTEVPAVVSNGDVAAAYSGVRRSSWKRKSSRRIDRFT
FPALEEDVIYDDVPCESPDAHPPGAERSLLYEDVHRDGAPREAEDLGWSSSEFESYSEGS
GEDTKPEVEPTKHRVSFQPKLSPDLTRLKERYARTKRDILALRVGGRDMQELKHKYDCKM
TQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDSEEEDMGLLEVSVSDIKPPAPEL
GPMPDGLSPQQVVRRHILGSIVQSEGSYVESLKRILQDYRNPLMEMEPKALSARKCQVVF
FRVREILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFSKSMVLDVYSDYVNNFTNAMSI
IKKACLTKPTFLEFLKRRQVCSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGHPDR
LSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSGQRQLLLCETL
TETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNT
ALPQVQVVEVGQDGGTYDKDNVLIQHAGAKKASAVGQAPNKVYLGPPRLFQELQDLQKDL
AVVEQITLLVSTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGKPD
KSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGWLCSDEDKKSKAPFWCPIL
ACCIPAFSSRALSLQLGAMVHSPVNCPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVEIFS
LNRPSPRTVKSFPLAAPVLCMEYIPEPEEEEAPAGDESGTAADPSATAHPTICLGLQDGS
ILLYGSVDTGTQCLATCRSPGLQPVLCLRHSPFHLLAGLQDGTLAAYPRTSGGVPWDLES
PPMCLTVGQGPIRTLLSLEDTVWASCGPQVTVLDASTLQTQQSFEAQQDEAVSVTHMVKA
GSGVWMAFSSGSSIRLFHTETLEHLQEINIATRTTFLLPGQKHLCVTSLLICHGLLWVGT
DQGVIVLLPVPRLEGIPKITGKGMVSLNGHCGPVSFLAVATSILAPDILRSDQEEAEGSR
AEEDKQDGQTHEPAPAPDSHMGRELTRKKGVLLQYRLRSTAHLPGLLLSMREPASADGSA
LEHSEEDGSIYEMADDPDVWVRSRPCARDAHRKEICSMAIISGGQGYRNFGSPSGSSGRP
APCGETDSTLLIWQVPLML
Download sequence
Identical sequences H0XBL1
ENSOGAP00000013100 ENSOGAP00000013100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]