SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013103 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013103
Domain Number 1 Region: 215-506
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.41e-78
Family WD40-repeat 0.000000000831
Further Details:      
 
Domain Number 2 Region: 94-208
Classification Level Classification E-value
Superfamily F-box domain 3.27e-31
Family F-box domain 0.000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013103   Gene: ENSOGAG00000014623   Transcript: ENSOGAT00000014629
Sequence length 526
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:19151304:19181010:-1 gene:ENSOGAG00000014623 transcript:ENSOGAT00000014629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKPAKQNKTNKQQPSSLFGGSGLGIRTRQTKLANGTSSMIVPKQRKLSASYEKEKELCVK
YFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSY
LDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPD
GNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSG
LRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTL
IHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYI
VSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACL
RVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVF
RLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR
Download sequence
Identical sequences H0XBL3
ENSOGAP00000013103 ENSOGAP00000013103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]