SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013120 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013120
Domain Number 1 Region: 1152-1307,1347-1426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.47e-42
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1476-1727
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-37
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 128-271,335-404
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.14e-29
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 671-899
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.14e-29
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013120   Gene: ENSOGAG00000014637   Transcript: ENSOGAT00000014647
Sequence length 1958
Comment pep:known_by_projection scaffold:OtoGar3:GL873601.1:548017:641301:-1 gene:ENSOGAG00000014637 transcript:ENSOGAT00000014647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPFGSLQTTNFRRFTPESLVEIEKQIAASEAAKKARGKHKEQTDQEDKPRPQLDLKAC
NQLPKFYGELPEELVGEPLEDLDPFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR
RTAIKMSIHSWFSLFITVTILVNCVCMTRNDLPERAEYIFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGSAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVRKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVRNSTAIGELANYSSHRESDDYIN
KPGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDSFVWAFLSLFRLMTQDSWER
LYQQTLRASGKFYMVFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATIDEIEAKEKKFQE
ALEILRKEQEVLAALKIDTASLHSHNESTLPSKNANERKHRMKPRVSQGSTDDNKSPQPD
PYNQAINAQSFLGLTSGRRRASHGSVFHFRGLAQDLSLPDGVTDDGVVTGDHESHRGSLL
LGGGAGQQGPLGPLPRSPLPQTTNSGSKHGEDGHLTLSTSDLEPVAVEVPAFDAEQKKTF
LSAEYLNEPFQAQRAMSVVSIITSVLEELEESEQRCPPCLTTLAQKYLIWECCPTWVKLK
TTLFELVTDPFAELTITLCIVVNTLFMAMEHHRMSAAFEAMLQIGNIVFTIFFTAEMVFK
IIAFDPYYYFQKKWNIFDCIIVTVSLLELGMAKKGSLSVLRTFRLLRVFKLAKSWPTLNT
LIKIIGNSVGALGNLTIILGIIVFVFALVGMQLLGENYNTNRRAISAPDEEWPRWHMYDF
FHSFLIIFRILCGEWIENMWACMQVGEKSICLVLFLTVMVLGNLVVLNLFIALLLNSFSA
DNLAAPEDDGEVNNLQVALVRIQVFGLRTKKALCSFFHRPCLIPQPKVEPKLVVKLPLSS
SKTENHIPANAAMGNLQGPRDEYGDFITNPNMWVSVPIAEGESDLDDLEDEAEEDARSSW
QDVIPKGQQEQLQQAERYEDQLAPRSPEGSGMSSSEDLAPYLGEKWQNEAVPQAPAKGVD
DTSSSEGSTVDCPDPEEILRKIPELADDLEEPDDCFTEGCIRHCPCCNVNTAKFPWAMGW
QMRKTCYRIVEHSWFESFIIFMILLSSGSLAFEDCYLDQKPTVKALLEYTDRVFTFIFVF
EMLLKWVAYGFKKYFTNAWCWLDFLIVNISLISLTAKILEYSEIAPIKALRTLRALRPLR
ALSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINTTNDDFS
LVSLSTVNNKSDCENQNSTGNLFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDS
REVDAQPKWEDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPLNKYQGFIFDIVTRQAFDIIIMVLICLNMITMMVETDE
QSEEKTKVLGKINQFFVAVFTGECVMKMFALRHYYFTNGWNVFDFIVVVLSIASLVFSAI
LKSLENYFSPTLFRVFRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMF
IYSIFGMSSFPHVRQEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCD
PNLPNSNGSRGNCGSPAVGIIFFTTYIIVSFLIVVNMYIAVILENFNVATEESTEPLNED
DFDMFYETWEKFDPEATQFITYSALSDFADTLSGPLRIPKPNRNILMQMDLPLVPGDKIH
CLDILFAFTKNVLGESGELDSLKANMEEKFMATNLSKSSYEPIATTLRWKQEDISATVIQ
KAYRSYVRHRSLALSNPPGVPRAEEEAVSLPDEGFVAFMANENCMLPDKSATVSATSFPP
SYDSVTRGLSDRVNMSTSSSMQNEDEEDTSKEVTSAGP
Download sequence
Identical sequences H0XBM7
ENSOGAP00000013120 ENSOGAP00000013120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]