SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013234 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013234
Domain Number 1 Region: 103-164
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013234   Gene: ENSOGAG00000014773   Transcript: ENSOGAT00000014776
Sequence length 167
Comment pep:known_by_projection scaffold:OtoGar3:GL873547.1:1816866:1817369:-1 gene:ENSOGAG00000014773 transcript:ENSOGAT00000014776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAYPQGCGDATVLDFVADLSLASPRHPLLCDFMPGAPFGGRAGALTLRERRPRRMARFE
EGCPEEEGELDEGDEEEEEEEERGRGASLLGRPKRKRVITYAQRQAANIRERKRMFNLNE
AFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKKSG
Download sequence
Identical sequences H0XBW9
ENSOGAP00000013234 XP_003788532.1.62490 ENSOGAP00000013234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]