SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013238 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013238
Domain Number 1 Region: 637-744
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 867-976
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000968
Further Details:      
 
Domain Number 3 Region: 324-427
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00083
Further Details:      
 
Domain Number 4 Region: 429-532
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 5 Region: 535-638
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00089
Further Details:      
 
Domain Number 6 Region: 26-132
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 7 Region: 740-847
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0034
Further Details:      
 
Domain Number 8 Region: 133-235
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013238   Gene: ENSOGAG00000014774   Transcript: ENSOGAT00000014780
Sequence length 1087
Comment pep:novel scaffold:OtoGar3:GL873594.1:31979:49250:-1 gene:ENSOGAG00000014774 transcript:ENSOGAT00000014780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYSLGLWPLLVTCWTLPPGLVGKESLSLLGGGNRCEGLLQVQYLGHQGPVCGDHWGMG
EASVTCRQLGCGPALSASKYVLRPQEIGPPWLHSAHCQGEEASLWECSLGTWGPLSSCEC
QCVAVITCSDGTMQQVRLGGGGSPCAGVPEVVNPAGSVLRCDLHKEEASVFCRQLGCGSA
LQWSTAHGRGDPGDKGQKFVTCQGTESLIFNCKMNLNFIAQCDLPVYTQVVCSGRDTLPT
HVALVRGGVSTCFCIPTVQWSGKGSQACVGAGGGEGEERSWAHVPLANFPGDLCFPRGQA
RGEFCCQGASPAVVSPVQHLPPGHTEARLVGGEHPCSGRLEVKRGLTWGTVCDADLDLAT
AHVVCRELRCGAAVSTPGGAHFGRGSGLAWTEAFRCAGNESLLFHCPRGPGSQCGHSRDA
GLTCSGEKFRLVNGSSSCEGRVELQVEGAWAPLCAAHWDLGDATVLCHQLKCGHAVATLR
GGHFGDGDAPIWPDAFHCEGTEPHLFNCTASTLGAPACAPGNSASAVCSAGLPHALRLRD
GQSHCDGRVEASLNGTWGRVLDDAWDVRGARVVCRQLGCGGAELAYDAQAPGHRAVPVGL
SRVHCLGNETRLGQCNLSVSLWETAGTSKDVGVVCSGSLRVRLAAGPGRCAGRVEVFHGG
AWGTVCDDAWDLQDAHVVCRQLGCGRALSAPGAAHFGAGAGLIWLDELGCQGQESALWQC
PSGAWGQHDCGHKEDAGVFCSEFTDVRLQNHSGPCAGRLEVFYNGTWGGVCQTLNAASLG
VLCEHLGCGPQGQLLAGAGSWPGPEARWLASIQCRDRHDRSLWQCPSAPWDPDSCSSGEE
AWVLCAEKAGVPQDLGESLNCSSTLSCPEEGALRVRGGSDNCSGRVELWHADSWGSVCDD
SWDLADAEVVCRQLGCGRAENALWGAAFGPGSGPVWLDEVGCRGSEVSLSECQAERWGHG
DCTHKEDAAVRCSGSPGTQAAPPPLAPPPAPEAWALLETACLVLGVLLGLVSLFLGTQWC
RHRAACQGCRMSGHPSWEGVYEDIGAMPLGEKAEGPAAPTDRVPEEEYDDAGEPEPEPED
EDRPGEE
Download sequence
Identical sequences H0XBX2
ENSOGAP00000013238 ENSOGAP00000013238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]