SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013287 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013287
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 3.27e-60
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013287   Gene: ENSOGAG00000014833   Transcript: ENSOGAT00000014838
Sequence length 209
Comment pep:known_by_projection scaffold:OtoGar3:GL873624.1:3498688:3533898:1 gene:ENSOGAG00000014833 transcript:ENSOGAT00000014838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYKTVQRLIPA
LWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSII
DMDAVCQRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQ
LGRALRAIIEEMLDVLEQSEGKINYCHKH
Download sequence
Identical sequences H0XC16
ENSOGAP00000013287 ENSOGAP00000013287 XP_003796611.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]