SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013312 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013312
Domain Number 1 Region: 1806-2088
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.05e-77
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00053
Further Details:      
 
Domain Number 2 Region: 678-844
Classification Level Classification E-value
Superfamily GroEL apical domain-like 9.68e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.00052
Further Details:      
 
Domain Number 3 Region: 354-485
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-29
Family DEP domain 0.0038
Further Details:      
 
Domain Number 4 Region: 155-227
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 
Domain Number 5 Region: 631-684,837-857
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0000122
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013312
Domain Number - Region: 1411-1514
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00448
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013312   Gene: ENSOGAG00000014853   Transcript: ENSOGAT00000014866
Sequence length 2102
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:22854741:22944309:-1 gene:ENSOGAG00000014853 transcript:ENSOGAT00000014866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDDPPFKSAYSSFVNLFRFNKERA
EGAQGEQQPLGGSWTSPQLPARTQSVRSPTPYKKQLNEELHRRSSAVLDTRRKAEPTFGG
HDPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHH
CRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDS
TCSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTALSTRLVSVQEDAGKS
PARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLW
KKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWL
DCVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQ
IAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPP
HPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREEN
GEKQAMERLLSANHNHMMALLQQLLHNDSLSPSWRDIIVSLVCQVVQTVRPDVKNQDDDM
DIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKNPKILLLKCSIEYLYREET
KFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQV
LERISRMTQGDLVMSMDQLLTKPHLGTCHKFYLQLFQLPNEQTKTLMFFEGCSQHLGCTI
KLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGQGSE
GAAQEQSSGSSFPWDPDILPESLSSDDSSLLESRIVFEKSEQESKSVPQAVASLKHQEYA
TTACPAGGLPCPPAFFPAVPESLLPLHVDDQQDAVGNEQPEALQQADELQDPKSQTKAFR
DPLQDDSGLYVAEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFLLTEKGMRCS
TRDYFAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKYIQVLPSHELVST
RIAEHLGDSQSLGRMLADYRARGGRIQPKYADPFAHSKDASGTSSGKSGSKTEDDEERGL
ISNDAVWSTKVDCLNPVNHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGI
FLERYCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWC
RICKQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQM
VASFSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYLAVDERLASLKT
DTFSKTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQS
LCEVLQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDASPRNISPGLQNGE
KEDRFLTTLSSQGSTSSTHLQLPTPPEVMSEQSVGGAPEPDTASSSEDVFDGHLLGSTDS
QVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALS
CKEYRNALEELSKATLWNSGEEGLPTTSTLDSRPKSSSPIRLPESSGGQTNRPAEAEPQP
TKKPSGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQMGKEGTENQGPEPPDEVDG
GDTQKKQITNPHVELQFSDANAKFYCRLYYAGEFHKMREVILGSSEEDFIRSLSHSSLWQ
ARGGKSGAVFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGV
YRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLD
ENLLKMVRDNPLYIRSHSKAVLRTSIHSDAHFLSSHLIIDYSLLVGRDDTSNELVVGIID
YIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGL
NC
Download sequence
Identical sequences H0XC36
ENSOGAP00000013312 ENSOGAP00000013312 XP_003785036.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]