SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013367 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013367
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.21e-43
Family Regulator of G-protein signaling, RGS 0.000000086
Further Details:      
 
Domain Number 2 Region: 786-867
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.16e-27
Family DIX domain 0.00000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013367   Gene: ENSOGAG00000014926   Transcript: ENSOGAT00000014931
Sequence length 867
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:6418835:6497362:-1 gene:ENSOGAG00000014926 transcript:ENSOGAT00000014931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELASTDPRPVSHSFCSGKGAGIKGETSTAT
PRRADLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLARAIYRKYILDNSGIVSRQTKPATKSFIKDCIVKQQIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPT
LNEDEEWKCDQDLEEDGGRDPAPPSRLTQKLLLETAAPRASSSRRYSEGREFRYGSWREP
VNSCYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGDDGDLSSGPLGTSHKLPPVPAWHHFQPRYVDMGCVGLRDAHEENPESILDEHVQRVLR
TPGCQSPGPGHRSPDSGHMAKMATVLVGGVSGHSKHLPKSAAKLDTAGLHHHRHIHHHVH
HSTARPKEQIEAEATRRVQGSFTWGPEPHSHGAKPRSYSESMGTTPGAGDSLAHSGKAGV
PSKRNAKKTDSGKGASVEVPGPSEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGARKPQ
AHESSRPVSLERPGTVHPWAGTQLRASVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLE
EEEKRASRPPSKQRYVQAVMRRGRTCVRPVCLPVLSEVPAVSDMELSETETKSQRKTGGG
NAQSCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGV
VFEEVREDEAVLPVFEEKIIGKVEKVD
Download sequence
Identical sequences H0XC78
XP_012661252.1.62490 ENSOGAP00000013367 ENSOGAP00000013367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]