SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013421 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013421
Domain Number 1 Region: 71-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000019
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 735-819
Classification Level Classification E-value
Superfamily PWI domain 0.00000196
Family PWI domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013421   Gene: ENSOGAG00000014986   Transcript: ENSOGAT00000014996
Sequence length 827
Comment pep:known_by_projection scaffold:OtoGar3:GL873715.1:2631938:2687463:1 gene:ENSOGAG00000014986 transcript:ENSOGAT00000014996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFPPHLNRPPMGIPALPPGIPPPQFPGFPPPVPPGNPPVFLPLELQAPSPKVLVPTVSM
VGKHLGARKDHPGLKTKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQ
GASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKASN
GNARPETTTTTTDDEEALDEETKRRDQMIKGAIEVLIREYSSELNAPSQESDSHPRKKKK
EKKEDKWELAESVRYKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEI
EKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRER
DRDRDRERSSDRNKDRSRSRREREREREREREREREREREREREREREREKDKKRDREED
EEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRL
KEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHP
DPDAELQRMEQEAERRRQPQIKQEPESEEEEEEKQEKEEKREEPIEEEEEPEQKPCLKPT
LRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGASN
SPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNAAKGTVNTEEKRK
HIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCS
KVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK
Download sequence
Identical sequences H0XCC0
ENSOGAP00000013421 ENSOGAP00000013421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]