SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013430 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013430
Domain Number 1 Region: 952-1100,1138-1215
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.61e-25
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 533-681,715-759
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.38e-22
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 3 Region: 1268-1458,1492-1516
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.47e-21
Family Voltage-gated potassium channels 0.028
Further Details:      
 
Domain Number 4 Region: 121-264,334-401
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.24e-17
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013430
Domain Number - Region: 1522-1568
Classification Level Classification E-value
Superfamily EF-hand 0.000701
Family Calmodulin-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013430   Gene: ENSOGAG00000015002   Transcript: ENSOGAT00000015007
Sequence length 1699
Comment pep:known_by_projection scaffold:OtoGar3:GL873609.1:5401577:5454391:-1 gene:ENSOGAG00000015002 transcript:ENSOGAT00000015007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASVEAKGLVPFTRESYELIKQRIAKKHNEEHEEEDLKADTDLEVGKKLPFIYGNLSQG
MVSEPLEDVDPYYYKKKNTFIVLNRDRTIFRFNASSILCTLSPFSSIRGTTIKVLIHPRT
LFRLLILISVLIDCIFMTMTDLPRWGPALENTLLGIYTFEIIIKLFARGFWAGSFSFLGD
PWNWLDFSVTLFEFITKCIPLNYILMLQKARTLRILKIIPLNQGLQSRMGTLIHCLKKLM
GAIILTLFFLSVFSLIGMGLFMGNLKHKCLWLPRENENETLHNRTGNPYYFRETEIFYYL
EGEINALPCGNRTDAGQCPEGYVCVKAGLNPDRGFTNFDNFGWAFLALFRLMTQDFPENL
YHQILYASGKVYMVFFVVVSFWFAFYMASLFLGILVMTYEEETQTATEKTNKTEPRFQEI
EKELQEGNEATEMKNIRYYKELIDSYGQHEEKCINVHSYRSIKKRKKIPTYIVTVLKILS
EXNLSNKSFISELKKSKKKCPLCWYRIAKLFLIWDCSPCWLKLKEFVHRIIMYPFTDLVL
ALCIILNVCFLALEHYPMSEEINSLLSIGNLVFIGIFTAEMILKIIAMHPYEYFQVGWNI
FDSVIVFLGLTELYLANIQGIYYFRLFRMLRIFKLGKYWPTFENLMLTLTNSVAALEDLV
LLLFTFIFFSAVLGMKLFGQSYREGVCHIDKDCQAPRWHMYDFFHSFLNVFRMLCGEWIE
TLWDCMEVAGRPWCISFYMMVILIGNLLILYLFLALVSSFRSHNAVTTEKNDETKNLQLA
LTRIQTGISHVFLKILCKKQNIPKERLDHALSELSNTQDFLTDKEKHSGTEKTTVTENES
QSPLPSPSVSETVPIASGESDIENVDNKEIQSKSGDGGSKEKIKPSSSSECSTVDIAISE
EEEMVCEHDRPKHLKNDDRRTSSLGQISRESKKGKMWQNIRKTCSKIVENEWFKCFIGLV
TLLSTGALAFEDIYIDQRKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYKL
DFMVVIVFCLSLIGKSREELKPLTSIKFLRALRVLSQFERMKVVVKALIKTTFPALNVFL
VCLLIWLAFSIMGVNLFAGKFYECIDPTSGERFPVSKVANKSECEGLVFNESVPWKNAKL
NFDNVGNGFLSLLQVATFNGWIDIMNSAVDSVEVNMQPDFEFSIYMYCYFINFIIFGLFI
PLSMLISVIITSFNKYKIQQGGPNIFITGQQRKQYRVLKKLMCEDSQRPIPRPRNKFQGF
IFDLVTNPVFNVIIMVIICLHTIILMIQSDEQGPEKEIAFYWINSTVVMLYAIECVLKLI
SFHCYYFTIGWNIFDFMVVIFSTTGLLLPMTVGYSIVPPSLVQLILLARIVHVLRLGKGP
KVFHDLMLPFVLSLPALLNIGLLIFLLMFVYAICGMYNFAYVKKEAGINDVSNFETFVSS
MLCLFQVTIFAGWDGMLKAIFRSEWSDCDPDKINPGTQVRGDCGSPSVGILYFVSYILLS
WLVIVNMYIVVVMEFLNISSKKKVKTLSEDDFKRFFQVWKRFDPDRTQYIDSSKLSDFAA
SLDPPLFMAKPNKSQLLALDLPMAVGDRIHCLDILLAFTKRVVGNDARVEKVLSEIESGF
LLANPFKITYEPITSTLKRKQEAVSARIIQRAYKNYRLRQQDKNTIDIRKIDADRDVQAP
KEGVYSDKAEEKSTVQSQS
Download sequence
Identical sequences H0XCC8
ENSOGAP00000013430 ENSOGAP00000013430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]