SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013438 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013438
Domain Number 1 Region: 654-739
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013438   Gene: ENSOGAG00000015010   Transcript: ENSOGAT00000015016
Sequence length 858
Comment pep:known_by_projection scaffold:OtoGar3:GL873596.1:2458804:2478198:-1 gene:ENSOGAG00000015010 transcript:ENSOGAT00000015016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGALAGLATGLQVPRIAPSPDSDSDSDTDSEDPNLRRSAGGLLRSQVIHSGHFMVSSPH
SDSLTRRRDQEGPGGLADFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRD
KIRLNNAIWRAWYIQYVERRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVM
REYHKWRIYYKKRLRKSSREGDLLAPKQADGRWPPPERWCEQLFSSVVPVLLGGPEEEPG
GRQLLDLECFLSDISDTLFTMTQPSPSPLQLPPEDAYVNNADMIQPDLTPLQPSLDDCME
ISDFFTNYRPPQTPTPSNFLEPPSFSPMADSFFSSGILGPEVTAASSGLTHLSGHGRLQA
RNSSPGPLDSSTFLSSEFLLPEDPKPRLPPPLTPPPLFQYSPPAKALGLEPCPPPPFPPM
APPPAVLQEESLFSPRLPFPTVPPGLGVSPLPVPTPFPPTPQPTPGPTTSPFPINLMATG
CPEPLFGPCFSTSQGTWPRGKPPSRGRKARPPTLAPATASPTVAATAGGSNPCLTQLLTA
AKPEQALEPPLVSSALLRPPGSPQETVPEFPCTFFPPTPAPTPARPPPGPATLAPSRPLI
VPKAERLSPPTPSGSERRLSGELNSTPSPGTLSIRISPPQPIIHRGRADNNKTENRRITH
ISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYIVMLQQERAAMQEEA
QQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSVL
IRPLFESFNGMVSTASLHSLRQTSLAWLDQYCSLPALRPTVLNSLRQLSTSTSILTDPGC
IPEQATRAVTEGTLGKPL
Download sequence
Identical sequences H0XCD5
ENSOGAP00000013438 ENSOGAP00000013438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]