SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013453 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013453
Domain Number 1 Region: 63-152
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000781
Family Snake venom toxins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013453   Gene: ENSOGAG00000015029   Transcript: ENSOGAT00000015032
Sequence length 180
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:1650965:1652773:1 gene:ENSOGAG00000015029 transcript:ENSOGAT00000015032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPPVQGWGRGRGAHPSRRRRPAPQRTPSRSPHIAHRPARSMLPAAMKGLGLALLAVLLCS
APAHGLWCQDCTLTTNSSHCTPKQCQSSDTVCASVRITDPSSSRKDHSVNKMCASSCDFV
KRHFFSDYLMGFINSGILKVDVDCCEKDLCNGVAGVERSPWALAGSLLLSLGPALLWAGP
Download sequence
Identical sequences H0XCE8
ENSOGAP00000013453 ENSOGAP00000013453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]