SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013458 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013458
Domain Number 1 Region: 307-651
Classification Level Classification E-value
Superfamily RNI-like 2.75e-50
Family 28-residue LRR 0.031
Further Details:      
 
Domain Number 2 Region: 101-159
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000356
Family VWC domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013458   Gene: ENSOGAG00000015031   Transcript: ENSOGAT00000015037
Sequence length 676
Comment pep:known_by_projection scaffold:OtoGar3:GL873607.1:7926542:7953767:1 gene:ENSOGAG00000015031 transcript:ENSOGAT00000015037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFAAFFCFVLLIIFQTDFGQNEEAPRKQRRKMYHRRLRKSSTSPKHRSNRQLGIPQTTT
VTPVARFPIVNSDYGVEEKFESFSNFLGVESSYNVLPGKKGHCLVKGITMYNKAVWSPDP
CSTCLCSDGRVLCDETICHPQTCPQTIIPEGECCPVCSDTEQTEPTNLLHKQLPPPQVET
DQVLGKEVLRSEEDEVEIKEDTERKKETPGWRDGEKLHNEGDGRGGKRKKPGEVRKPAHQ
QQKRREEEEEEEEEEDEEEEEEVEEEEDAVRGDTFRVPPRFPVPAPPRCKTRLPNGCSLS
YKTISCIDITLTQIPPLTAPEITSLELVGNSIASIPDEAFNGLPNLERLDLSKNNITSSG
IGPKAFKLLKKLMRLNMDGNNLTQIPSGLPSTLEELKINDNNLQAMDEESLADLNQLVTL
ELEGNNLSEANVNPLAFKPLKSLLYLRLGKNKFRIIPQGLPSSTEELYLENNQIEEITEI
CFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVL
IGNQIDRIPGYVFGHMEPGLEYLYLSFNKLTDDGVDCVSFYGAYHSLRELFLDHNDLKSI
PPGIQEMKALHFLRLNNNKIRNILPEQICNAEEDGESTLEHLHLENNYIKTREIPSYAFS
CIRSYSSIVLKPQNIK
Download sequence
Identical sequences H0XCF2
ENSOGAP00000013458 XP_003795090.1.62490 ENSOGAP00000013458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]