SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013479 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013479
Domain Number 1 Region: 36-78
Classification Level Classification E-value
Superfamily F-box domain 0.00000563
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013479   Gene: ENSOGAG00000015054   Transcript: ENSOGAT00000015061
Sequence length 455
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:24963752:24992673:1 gene:ENSOGAG00000015054 transcript:ENSOGAT00000015061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRINTSFTLIPNQKRRRSNRRSCYFSNTLGSDSHPLSALGNFKALPLEIFQIILRYLS
VKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHKLELPGRRQDFTILEHYRSLGNL
CSKCLFLNIISCRGSVIKKVNTEKVSCFKFNGCATPLQCLGLPCYGMFLQQFGWGWWNVL
KCDLYFSFIICILTFLGRMVDSSFVLIGSARKLELRIRLFCRSVLLDHWTHRSDSAFWLT
RILKPWPMVNQARLLYIIFGPISSQDGQVVWQKMIEGPTDESSLKGLADAIKLLYDTGTK
EWTADDVISLVDELSVKVVPREWLLENNARLLILSGNNICFTFMASKAVNGRAIELARLI
VFLALVCEKELYCMNWAVKMMQKVCNVFSTPLERINFLQNVANAFACVTMEMLQSITSGD
HDEDDRSFLNLFHLVHAQANFHKEVLYLTMNTFST
Download sequence
Identical sequences H0XCG7
ENSOGAP00000013479 ENSOGAP00000013479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]