SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013501 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013501
Domain Number 1 Region: 1781-2027
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.89e-52
Family Ankyrin repeat 0.000000054
Further Details:      
 
Domain Number 2 Region: 1097-1229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000259
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 3 Region: 555-685
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000541
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 373-497
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000957
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 872-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000025
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 6 Region: 743-876
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 986-1025
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000447
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 8 Region: 909-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000687
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 9 Region: 718-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000136
Family EGF-type module 0.004
Further Details:      
 
Domain Number 10 Region: 106-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000718
Family EGF-type module 0.018
Further Details:      
 
Domain Number 11 Region: 493-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000255
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 12 Region: 221-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000435
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 142-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000768
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 14 Region: 944-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 15 Region: 27-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.025
Further Details:      
 
Domain Number 16 Region: 252-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 17 Region: 1337-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000332
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 183-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 19 Region: 1385-1417
Classification Level Classification E-value
Superfamily Notch domain 0.0000000994
Family Notch domain 0.0015
Further Details:      
 
Domain Number 20 Region: 1266-1306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.016
Further Details:      
 
Domain Number 21 Region: 1225-1269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000157
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 22 Region: 69-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000191
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 23 Region: 1025-1067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.021
Further Details:      
 
Domain Number 24 Region: 677-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.02
Further Details:      
 
Domain Number 25 Region: 1464-1495
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013501
Domain Number - Region: 1427-1458
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0951
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013501   Gene: ENSOGAG00000015075   Transcript: ENSOGAT00000015084
Sequence length 2432
Comment pep:known_by_projection scaffold:OtoGar3:GL873592.1:1381135:1536503:-1 gene:ENSOGAG00000015075 transcript:ENSOGAT00000015084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCKKNRCQNGGTCVAQAMLGKATCRCAPGFTGE
DCQYSTSHPCFVSHPCLNGGTCHMLSRDTYECTCQVGFTGKLCQWTDACLSHPCANGSTC
TTVANQFSCRCLAGFTGQKCETDINECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQHCD
SVYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGV
NTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGEDCSENI
DDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQY
ICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINE
CHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCL
CPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENINNCDPDPC
HHGQCQDGIDSYTCICNPGYIGAICSDQIDECHSSPCLNDGRCIDLVNGYQCNCQPGTSG
VHCEINFDDCASAPCVHGVCMDGISRYTCVCSPGFTGQRCNIDIDECASNPCRKGATCIN
DVNGFRCVCPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCDMDKD
ECLSNPCQNGGICDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCVDDISGYTC
QCVLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESYSCLCAPGWQGQRCTIDIDECVS
KPCMNHGLCHNTQGSYMCECPPGFSGVDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLP
GFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNG
GTCVDGINSFSCLCPVGFTGPFCLHEINECNSHPCLNEGTCVDGLGTYHCTCPLGYTGKN
CQTLVNLCSRSPCKNKGTCIQEKAESRCLCPSGWAGAYCDVPNVSCEVAASRRGVPVDRL
CQHSGVCISAGSTHHCQCPLGYTGSYCEEQLDECVSNPCQHGATCSDFIGGYRCECVPGY
QGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENVDDCAGGPHCLNGG
QCVDRIGGYSCHCLPGFAGERCEGDINECLSSPCSSEGSLDCVQLTNDYLCVCRSTFTGR
HCETFVDVCPQMPCLNGGTCAVASNVPDGFICRCPPGFSGARCQSSCGHVKCRRGEQCVH
TASGPRCFCPDPRDCESGCASGPCQHGGSCYPQRQPPYYSCQCPPPFWGSRCELYMAPTS
TPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMEDPWANCSSPLPCWDYINNQ
CDELCNTAECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADWP
ENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAA
MKKHRMTRRSLPGEQEQEVAGSKVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTL
SYPLVSVVSESWTPKPTQLLYLLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRR
DASNHKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGPQPKKVKAEDEALLSE
EDDHVDRRPWTQQHLEAADIRRTPSLALTPPQAEQDVDVLDVNVRGPDGCTPLMLASLRG
GSSDVSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDA
GADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGM
VAELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAR
EGSYEAAKVLLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSA
LSPVICGPNRSFLSLKHTPVGKKPRRPNTKSTMPTSLPNLAKEAKEAKGNRRKKSLSEKV
QLSESSVTLSPVDSLESPHTYVSDATSSPMITSPGILQASPNPMLAAAAPAAPVHTQHAL
SFSNLHEMQPLAHGAGTVLPSVSQLLSHHHIVPPGSGSAGSLGRLHPVAVPADWMNRVEV
NETQYNEMFGMVLASAEGAHPGMAPQSRPPEGKHMAAPREPLPPIVTFQLIPKGSITQPA
GAPQPQSNCPAAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQDEQVAQTILPAYHPFPAS
VGKYPTPPSQHSYVSSNAAERTPSNSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDV
TTSPTPGGAGGGQRGPGTHMSEPPHSSMQVYA
Download sequence
Identical sequences H0XCI2
ENSOGAP00000013501 ENSOGAP00000013501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]