SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013513 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013513
Domain Number 1 Region: 540-976
Classification Level Classification E-value
Superfamily RNI-like 1.18e-72
Family 28-residue LRR 0.000032
Further Details:      
 
Domain Number 2 Region: 5-88
Classification Level Classification E-value
Superfamily DEATH domain 7.89e-17
Family Pyrin domain, PYD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013513   Gene: ENSOGAG00000015091   Transcript: ENSOGAT00000015096
Sequence length 1037
Comment pep:novel scaffold:OtoGar3:GL873610.1:8129840:8147682:1 gene:ENSOGAG00000015091 transcript:ENSOGAT00000015096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESFSAAFDLLWYLQKLSDEEFHSFKSHLIAEIQKFGPPEILWTDLEVSKEVLVNMLTV
SYEEQHTWNMTFSILQKLGRKDLCQKITIRRNRDKEMYKSLMRTKFLNQWETCPFSEIHY
LYFCEVTKDIFYTLELSYDSSTSSTENLNVFLVGDRAKGKSMIIRVAVIEWTLGEMWNDT
ISYIIHITSHEINEMTNVSLVELISKDWPEDQAPIADILSEPQKVLFILEDLDNMNISLN
VDESALCSDSRHKVPVSVLFVSLLKRKVVPGCRVLVSSRPSCEPCIKALMNERDCYVTLQ
LSKEKKQNYFYLFFKNKVRAERAFKRVLDSEILVDLCEIPLLSWILCTVLNQQMNRLDFE
YSCQTPTDIYTYYLASLLTSDPDVTAQQYHLILLNRLCLLALEGLSHNTISFSGSDLVSV
GLTCYDVSVLQAMNILLRSSNHEVHYEFIHLNIQEYCAALACLMVLPHCSIPSARSTDKE
KRELYDNFSPVITFIFGLLNERRRKILETSLGCQFPMVESVTQNLVMHMKYLAANPNLME
HHMPLFYCLLEYVDEEFVTQVMGFFSEATIFIQDHKDLMASLHCLRHCQPLQKLKLIVQQ
VFQYGTPIELLTYNQMRGLAYWREICSIFHNRENFRELEIYNSDLNRVSEMLLSKALRHP
NCQLQTLRLSYVSVSADFDDLFMSVAQNQNLTFLNMNCIPFSLEMFSLLREALSSPTCNI
QHLSLMRCDLQASACREIAFILISSRKLKKLTLSNNPLKNDGAIILCEALLHPDCVLESL
GLYFCCLTEGCACYISRLLICTRTLKHLDLSVNYLQSHAVMTLTFPLSLSDCQLRELELT
GCFFTGNACQCIADAIVCNVNLRRLELGYNNLGDAGVEALCSGLQDPDCKLESVGLECCM
LTSACCTTLATVLSISKTLKKLNLKENNLGDEGIIKLIQGLGHPSCVLELLGIRVSDFSA
ETQSLLIAVREKNNKLVFSSSFSTAQESRQFTDLLGSGSLPEPVSKTPNYPWHSIFFKLP
RKFSSTTEETIVSEQSL
Download sequence
Identical sequences H0XCJ1
ENSOGAP00000013513 ENSOGAP00000013513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]