SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013522 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013522
Domain Number 1 Region: 612-1012
Classification Level Classification E-value
Superfamily RNI-like 2.43e-63
Family 28-residue LRR 0.0000297
Further Details:      
 
Domain Number 2 Region: 5-94
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-27
Family Pyrin domain, PYD 0.0037
Further Details:      
 
Domain Number 3 Region: 192-309
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000926
Family G proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013522   Gene: ENSOGAG00000015098   Transcript: ENSOGAT00000015107
Sequence length 1019
Comment pep:novel scaffold:OtoGar3:GL873535.1:11804606:11821756:1 gene:ENSOGAG00000015098 transcript:ENSOGAT00000015107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMASSFFSDFGLIWYLEELNKKEFKKFKEHFKQETLKLELKQISWTKVKKSSREDLANLL
IQQYEAQQAWNLTLRIFHRLGRQDLCDKVQRERTGDCHHLLFLVDGFCACPSQGQNVLWE
NIVLFLFQINLRVQSLDYTVFISKSKLRTCIQARNSRQCFSVFLFSHLSLIKEKEKSKSI
TDFFECFGENVRPEELKYMHLLFAAKETGQRSHTTVLQGAQGVGKTTFLMKLVLGWAEGS
LFQDKFLYVFYFCCRELRQVKETSLADLMSRNWPYPSPAPITEIVTHPEKLLFIIDSFEE
LKCDLSEPESDLCGDWMKQQPVRALLSGLLRKKMLPEASLLVAVTPVCPAELQARLVCPE
LITLSGFSEGEIELYFRSLFPSRNRAAEAFRSVRENAQIYSLCHAPRICWVIGTCMKQAV
EKGRELAPICRCLTSLYASSILNLFTDKDASCPSPQSRVRLRGLCSLAVEGMWTDVFEFH
DEDLRRNGIADLDVPALLDTNIFLKCTESSYTFAHRSIQEFCAAMFYLLRRDHPNPAVRS
RETLLAAHLKKVKKARWIHWGSFLFGFLNEKEQEKVDKFFGFQPSQEIRQQFHQILKNLE
ECEGLRGQTDFLALFYCLFEMEDAVFVKEAVNFLQDINFSINNELDLEVCAYCLKYCSGL
RRLSFSVPKVIEEDGRGCRRPWLTTGCVVDMKQHFSESMSFLFDHRSSCNVVHWHHIFCV
FITNEHLKELEIINTDFCQSSLEILCNQLRFPTCHLEKLQLNCVSFSGGSSVFFEVLSHS
PDLKYLNLRNVNLSCDDMKILCKVLSSSMCNIEQLVFFCCCLACVICMDLLHAVLSKKSL
CSLDLSTSSLYNKGLKVLCAALRHPDCCLQSLGLANCSFTAAGCQDLASVLTSNQKLTSL
QIGLNKIGDVGVKVLCDALTHPNCHLEILGLKDCGLTSACCRDLYSALTNSRTLRVLDLT
LNTLDHRGVAVLCEALKYTACPLWFLGLPKTRVDEETQMLLTAVEERNPHLTVHREPGL
Download sequence
Identical sequences H0XCK0
ENSOGAP00000013522 ENSOGAP00000013522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]