SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013556 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013556
Domain Number 1 Region: 342-445
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013556
Domain Number - Region: 163-258
Classification Level Classification E-value
Superfamily STAT 0.0029
Family STAT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013556   Gene: ENSOGAG00000015140   Transcript: ENSOGAT00000015145
Sequence length 446
Comment pep:known_by_projection scaffold:OtoGar3:GL873640.1:1498676:1563344:1 gene:ENSOGAG00000015140 transcript:ENSOGAT00000015145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDRRMEQGDPFLDQQEDSDSCSESVKFDARSMTALIPLNPKNGATIQEKLKFFKAALIAL
YLLVFAVLIPIIGIVAVKYAAHLLKWETKTCVVGSVNEHGASQSLQGRGNSSEEATRFPE
AEASPVDSEQFQNFSVTTDQRFSDVLLQLRGLVSSVRERGDALDELAQSLTALNVTLLGV
QLGMDKLNDKIQENAIKHQEEISKLEERVSKASAEITSMKEEQGHLEKEIKGEVTILNNI
TNDLRLKDWEHSQTLKNITLIQGPPGPPGEKGDRGPPGETGPQGIPGARGMIPGSLKGDR
GAIGFPGSRGLPGSTGRPGIKGNPGQKGQKGEKGSRSTTTQSRTIRLVGGSGPHEGRVEI
LHNGQWGTICDDRWEIREGQVVCRSLGYPGVQSVHKGAHFGQGTGPIWLNEVLCFGRESS
IEECKIRQWGVRVCSHSEDAGVTCTL
Download sequence
Identical sequences H0XCM9
ENSOGAP00000013556 ENSOGAP00000013556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]