SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013611 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013611
Domain Number 1 Region: 2672-2962
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 1278-1457
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 3 Region: 1919-2112
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.28e-50
Family DBL homology domain (DH-domain) 0.0000212
Further Details:      
 
Domain Number 4 Region: 1464-1584
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 2113-2230
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-31
Family Pleckstrin-homology domain (PH domain) 0.00065
Further Details:      
 
Domain Number 6 Region: 2501-2662
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-24
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 7 Region: 276-412
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 8 Region: 1096-1233
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 9 Region: 498-639
Classification Level Classification E-value
Superfamily Spectrin repeat 2.98e-17
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 10 Region: 842-999
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000168
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 2320-2383
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000833
Family SH3-domain 0.0000302
Further Details:      
 
Domain Number 12 Region: 1643-1708
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000847
Family SH3-domain 0.0035
Further Details:      
 
Domain Number 13 Region: 33-179
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000017
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 14 Region: 189-307
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 15 Region: 644-764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000877
Family Spectrin repeat 0.004
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013611
Domain Number - Region: 781-874
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000761
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013611   Gene: ENSOGAG00000015184   Transcript: ENSOGAT00000015204
Sequence length 2985
Comment pep:known_by_projection scaffold:OtoGar3:GL873608.1:1045824:1527398:-1 gene:ENSOGAG00000015184 transcript:ENSOGAT00000015204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRRLWPWTPLWPDSLLCCPTGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFPA
RSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAE
IHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHDE
WIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPV
EELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVR
KLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSM
NAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQ
KAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDVL
QRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQ
QDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAE
QLAQTGECDPEEIYKAARHLEVRTQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQK
EMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSEAR
DSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVT
AELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEV
QASGIELICEKDIDLGAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQV
LGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQQK
AEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESL
EQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHR
NNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQA
LDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKG
HIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREV
KLRDATHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGI
LNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDS
NQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDG
LEVMLSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFE
ISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKA
SNIETKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKQRNNSKRDGVEDIDSQGDGS
SQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPSER
PGWCLVRTTERSPPQEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSESV
ANLQAQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKTDGNIKKQKKVRDGRKSFDL
GSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSSLLAA
RQASTEVPTAADLVSAIEKLVKSKLSLEGGSYRGSLKDPAGCLNEGMAPPTPPRNLEEEQ
KAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIHQI
YDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDTYFEEV
KQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCN
DMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRK
GSLTPGYMFKRSIKMNYLVLEENVDSDPCKFALMNRETSERVILQAANADIQQAWVQDIN
QVLDTQRDFLNALQSPIEYQRKERSTAVMRSQPARVPQASPRPYSSVPVGSEKPPKGSTY
NPPLPPLKISTSNGSPGFDYHQPGDKFETSKQNDLGGCNGTSSMAVIKDYYALKENEICV
SQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLTKATAAAENSDGSIKKSC
SWHTLRMRKRAEVENTGKNEATGPRKPKDILGNKVSVKETNSSEESECDDLDPNTSMEIL
NPNFIQEVAPEFLVPLVDVTCLLGDTVILQCKVCGRPKPTITWKGPDQNLLDTDNSSATY
TVSSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQERS
RTSVILRWLPPSSTGNCTISGYTVEYREEGSQIWQQSVASTLDTYLVIEDLSPGCPYQFR
VSASNPWGISLPSEPSEFVRLPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKKC
IHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELMD
DGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVK
LIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFL
DESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPH
NGSYSKIPLDTSRLACFIERRKHQNDVRPVPNVKSYIVNRVNQGT
Download sequence
Identical sequences H0XCS3
ENSOGAP00000013611 ENSOGAP00000013611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]