SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013638 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013638
Domain Number 1 Region: 339-425
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 6.41e-21
Family HSP40/DnaJ peptide-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 224-300
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 7.46e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.00033
Further Details:      
 
Domain Number 3 Region: 90-201
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.72e-17
Family Chaperone J-domain 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013638
Domain Number - Region: 209-245,304-334
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000227
Family HSP40/DnaJ peptide-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013638   Gene: ENSOGAG00000015227   Transcript: ENSOGAT00000015236
Sequence length 481
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:10871743:10905518:1 gene:ENSOGAG00000015227 transcript:ENSOGAT00000015236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQWSTRWLLVAVGTPRLPAAAGKGARLLRERVVGASLVRKLSVTAFAPSLGARGPRAL
LTLRPSVSLAGTKSYPFICTAFIHTSAPLAKEDYYQVLGVPRNASQKEIKKAYYQEEKSS
EHDDMNKTYPQLLAAYENVIEKLKVLSDEVKRKQYDAYGSAGFDPGASSSGQSYWRGGPT
VDPEELFRKIFGEFSSSSFGDFQGVFDQPQEYVMELTFNQAAKGVNKEFTVNIMDTCERC
DGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAK
QKKRVVIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQAIL
GGTARAQGLYETINVTIPPGIQTDQRIRISGKGIPRINSYGYGDHYIHIKIRVPKRLTSR
QQSLILSYAEDETDVEGTVNGVTLTSSGGSTTDSSAGSKARREAGEDKEGFLSKLKKMFT
S
Download sequence
Identical sequences H0XCU6
ENSOGAP00000013638 ENSOGAP00000013638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]