SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013648 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013648
Domain Number 1 Region: 227-335
Classification Level Classification E-value
Superfamily F-box domain 2.62e-16
Family F-box domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013648   Gene: ENSOGAG00000015240   Transcript: ENSOGAT00000015246
Sequence length 358
Comment pep:known_by_projection scaffold:OtoGar3:GL873633.1:5207688:5240607:-1 gene:ENSOGAG00000015240 transcript:ENSOGAT00000015246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLGQDWRSPGWSWIKTEDGWKRCESCSQELGRESNQCDISHSIILNSEDEGIFNDEER
EYASKKRKKDHFRNNTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIR
RFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL
CILIRGVGKSVLVGNINIWICRLETILTWQQQLQNLQMTKQVDSGLTLSDLPLHMLNNIL
YRFSDGWDIVTLGQVTPTLYMLSEDRQLWKRLCQYHFAEKQFCRHLILSEKGHVEWKLMY
FALQKYYPTKEQYGDTLHFCRHCSILFWKDSGHPCTAADPNSCFTPVSPQHFIDLFKF
Download sequence
Identical sequences H0XCV4
XP_003797329.1.62490 ENSOGAP00000013648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]