SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013770 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013770
Domain Number 1 Region: 312-393
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013770   Gene: ENSOGAG00000015380   Transcript: ENSOGAT00000015383
Sequence length 395
Comment pep:known_by_projection scaffold:OtoGar3:GL873663.1:3236445:3241397:1 gene:ENSOGAG00000015380 transcript:ENSOGAT00000015383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVCADCRAAPSGPGAGTLQVAGGGSEGADMDFDSYQHYFYDYDCGEDFYRSTAPSEDIW
KKFELVPSPPTSPPWGSSPGAGDLAPAIGPPEPWPGGGAGDEAESRGHSKAWGRNYASII
RRDCMWSGFSARERLERAVSDRLAAGAPRGNPPKAPTAPDCTPSLEAGTPATAAPCALGE
PKTQACSGSESPSDSEGEEIDVVTVEKRQSLAIRKPVTITVRADPLDPCMKHFHIAIHQQ
QHNYAARFPPESCPQEGAPERDSQEEALGDGNAPEEKEGEEDEETVSPLPTESEAPRSYH
PKPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEY
LQALVGAEKRMATEKRQLRCRQQQLQKRIAYLSGY
Download sequence
Identical sequences H0XD52
ENSOGAP00000013770 ENSOGAP00000013770 XP_003799035.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]