SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013786 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013786
Domain Number 1 Region: 218-332
Classification Level Classification E-value
Superfamily F-box domain 1.22e-16
Family F-box domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013786   Gene: ENSOGAG00000015395   Transcript: ENSOGAT00000015400
Sequence length 355
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:6848811:6880625:1 gene:ENSOGAG00000015395 transcript:ENSOGAT00000015400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLGQDWRSPGQSWVKTADGWKRFLDERSGSFVSDLSSYCNKEVYNKENLFNSLNYDVA
AKKRKKDIMNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
YVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTL
VQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRL
SDGRDLVSLGQVAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
IRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Download sequence
Identical sequences H0XD61
XP_003782410.1.62490 ENSOGAP00000013786 ENSOGAP00000013786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]