SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013829 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013829
Domain Number 1 Region: 421-573,607-672
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000408
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 120-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000706
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013829   Gene: ENSOGAG00000015440   Transcript: ENSOGAT00000015447
Sequence length 794
Comment pep:known_by_projection scaffold:OtoGar3:GL873557.1:14473805:14510981:-1 gene:ENSOGAG00000015440 transcript:ENSOGAT00000015447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLSDTVVSDSLSSSNADGGSYAIHDSQTPSLSSGGESSPSTPSRPNWEMNYQEAAIYLQ
EGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELSTALLLLLLSLCEAPAVPALRLGIYV
HATLELFALMVVVFELCMKLRWLGLHTFVRHKRTMVKTSVLVVQFVEAIVVLVRQTSHVR
VTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLLLFFMVIFAILGFYLFSPNPS
DPYFNTLENSIVSLFVLLTTANFPDVMMPSYSRNPWSCVFFIVYLSIELYFIMNLLLAVV
FDTFNDIEKRKFKSLLLHKRTAIQHAYHLLVSQRRPAGISYRHFEGLMRFYKPRMSARER
YLTFKALNQSNTPLLSLKEFYDIYEVAALKWKTKKNREHWFDELPRTAFLIFKGINILVK
SKAFQYFMYLVVAVNGIWILVETFMLKGGNFFSKHVPWSYLVFLTIYGVELFLKVAGLGP
VEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRPLQLLRLFKLKKRYRNVLDT
MFELLPRMASLGLTLLIFYYSFAIAGMEFFYGILYPNCCNTSTVADAYRWLNHTVGNRTV
VEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQTSHWSRLYFMTFYIVTMVVM
TIIVAFILEAFVFRMNYSRKNQDSEVDSGITLEKEISKEELVAVLELYREARGASCDVTR
LLETLSQMERYQQNSMVFLGRRSRTKSDLSLKMYQEEIQEWYEEHAREQEEQQRLSVPIA
QQPPGLRQRSQTIT
Download sequence
Identical sequences H0XD96
ENSOGAP00000013829 ENSOGAP00000013829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]