SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013904 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013904
Domain Number 1 Region: 534-855
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.59e-108
Family PDEase 0.0000000000132
Further Details:      
 
Domain Number 2 Region: 145-339
Classification Level Classification E-value
Superfamily GAF domain-like 8.29e-44
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 325-529
Classification Level Classification E-value
Superfamily GAF domain-like 2.09e-37
Family GAF domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013904   Gene: ENSOGAG00000015526   Transcript: ENSOGAT00000015531
Sequence length 873
Comment pep:known_by_projection scaffold:OtoGar3:GL873683.1:1582632:1712031:1 gene:ENSOGAG00000015526 transcript:ENSOGAT00000015531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAGPDFGRQQQQQQQQQQQQWDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERV
HTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTV
SFLSDSEKKEQMPLTPPRFDNDDGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISA
DRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNI
KDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKD
FAAYLAFCGIVLHNAKLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFM
QVQKCTIFIVDEDCSTSFSEIFHSVMQKAGKKSDKDIRERDANKINYMYAQYVKNTMEPL
NIPDVSKDKRFPWTNENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTDKVK
PFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQS
LAAAVVPSAQTLKITDFCFSDFELSDLETALCTIRMFTDLRLVQNFQMKHEVLCRWILSV
KKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGVNN
SYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILA
TDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELV
ATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPL
LDGCRKNRQKWEALAEQQEKMLINGESSQATRN
Download sequence
Identical sequences H0XDG0
ENSOGAP00000013904 ENSOGAP00000013904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]