SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013955 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013955
Domain Number 1 Region: 11-227
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.87e-60
Family Proteasome subunits 0.000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013955   Gene: ENSOGAG00000015584   Transcript: ENSOGAT00000015585
Sequence length 273
Comment pep:known_by_projection scaffold:OtoGar3:GL873670.1:1052103:1054424:1 gene:ENSOGAG00000015584 transcript:ENSOGAT00000015585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKLAMEPRGGFSFENCQRNASLERVLPGLRVPHARKTGTTIAGLVFRDGVILGADTRAT
NDSVVADKNCEKIHFIAPKIYCCGAGVAADAEMTTRMVASNMELHALSTGREPRVATVTR
ILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQGAALAVLEDR
YQPNMTLEAAQGLLVEAITAGILGDLGSGGSVDACVITGTGAKMLRTLSSPTEPIKRPGQ
YHFVPGTTAVLTHTVKPLDLELLEETVQAMEVE
Download sequence
Identical sequences H0XDK7
XP_003799424.1.62490 ENSOGAP00000013955 ENSOGAP00000013955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]