SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013972 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013972
Domain Number 1 Region: 539-566,610-689
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000647
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013972   Gene: ENSOGAG00000015601   Transcript: ENSOGAT00000015604
Sequence length 705
Comment pep:known_by_projection scaffold:OtoGar3:GL873717.1:382585:385411:-1 gene:ENSOGAG00000015601 transcript:ENSOGAT00000015604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVIPEPLQHSRGLVLVRRQPPVPQGLRRTLKARLLQRCTCSLPRAQALLQDLIPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANIIYFLMGTSHH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDSLGPRANGSILNDSATTLVLRPPDCGRDC
YAIRIATALTLVAGVYQVFMGILQLGFVSTYLSQPLLDGFAMGASVTILTSQLRHLLGVR
MPRHQGPGMVVSTWLSLLHNASQANLCDVVTSTVCLAVLLAAKELSDRCRHRLRVPLPTE
LLVIVVATTVSHFGQLHERFGSSVAGDIPTGFVAPRVPDPQLMQRVALDAVALALVGSAF
SISLAEMFAHSHGYSVRANQELLAVGCCNVLPAFFHCFATSAALAKSLVKTSTGCRTQLS
SVVSAAVVLLVLLALAPLFRDLQRSVLACVIVVSLRGALRKVRELPQLWRLSPPDAVVWV
GTAATSVLVSTEAGLLAGVILSLLSLAGRTQRPHTALLARIGDSDFYEDTTEFEGLIPEP
GVQVFRFAGPLHYANKDFFLQSLYSLTGLDAGRLAARGKEPGSEAEASERDPVDSKDPGS
VSTRAALVSTAASFHTVVIDCAPLLFLDVTGMATLQGLRQDYMALGISLLLACCSPPVRD
ALRRSGFLTEDEGSVAEKQLFHTVHSAVLAARARHGELAAADSTL
Download sequence
Identical sequences H0XDM1
XP_012667738.1.62490 ENSOGAP00000013972 ENSOGAP00000013972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]