SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013974 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013974
Domain Number 1 Region: 5-223
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.56e-49
Family LplA-like 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013974   Gene: ENSOGAG00000015602   Transcript: ENSOGAT00000015606
Sequence length 231
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:27881708:27882872:1 gene:ENSOGAG00000015602 transcript:ENSOGAT00000015606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQPAVRLVWLGRVRYTELLAVQDRWLRQLQAGPGTEALSGTEAGALLLCEPVGPMYTTG
LRGGLTPKETARLRTLGAEVCATGRGGLATFHGPGQLLCHPVLDLRRLGLRLRTHVAALE
ACAVRLCEFLGLLDARARPPPYTGVWLEERKICAIGVRCGRHITSHGLALNCSTDLTWFE
HIVPCGLVGTGVTSLSKELQRHITVDEVMPPFLVAFKEIYKCTLISEDSCS
Download sequence
Identical sequences H0XDM2
ENSOGAP00000013974 XP_003781412.1.62490 ENSOGAP00000013974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]