SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014052 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014052
Domain Number 1 Region: 433-575,627-826,855-937
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.77e-53
Family Tandem AAA-ATPase domain 0.017
Further Details:      
 
Domain Number 2 Region: 208-262
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000314
Family F-box domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014052   Gene: ENSOGAG00000015682   Transcript: ENSOGAT00000015688
Sequence length 1043
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:24322749:24353700:-1 gene:ENSOGAG00000015682 transcript:ENSOGAT00000015688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRLFKRKHLTAVDCQHLAPSHLSVAQPFGRRWTSRDPNHGLYPKPRTRRGSRAQGWQRQN
PELFLAGQQLCTNDMAKSSSVGQDGCQDSEGNMIFAAESSCALPQEHDGEARSGTSRPPL
PTKRSLSLEEESNQASGTSRWDGVSKKTPRHHLSVPCPRPREARWGAEDCSRLSMESGET
DLDIGDIGPDPIPDSYYGLLGTSPCLEAPSHICSLPSEVLRHVFAFLPVEDLYWNLSLVC
RLWREIVRDPLFIPWKKLYHRYLMNEEQAVSKVDGILLTYGIEKESDLCVLNLIRYTATT
KCSPSVDPERVLWSLRDHALLPEAEACVRHQLPDLYAAAGGVNVWALVTAVVLLSSSVND
IQQLLFCLRRPSSTVTMPDVTETLYCIAVLLYAMREKGINISNRIHYNIFYCLYLQENSC
AQATKVREEAAVWPSKKTIQLTHEQQLILNHKMEPLQVVKIMAFAGTGKTSTLVKYAEKW
SQSRFLYVTFNKSIAKQAEHVFPSNVTCKTFHSMAYGHVGRKYQSKKKLNLFKLTPFMVN
SVLAPGKGGFIRAKLVCKTLENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLNGVL
EASRLWDNMRKLGEGTEEAYQMTHDGYLKLWQLSKPLLASYDAIFVDEAQDCTPAIMNIV
LSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCK
RVRKKTLVGGNHQSSIRGDTKGQVALLSRTNANVFDEAVRVTEGEVPSRIHLIGGIKSFG
LDRIIDIWILLQPEEERKKRNLVIKDKFIRRWMHKEGFSGFKRYVTAAEDKELEAKIAVV
EKYNIRIPELVERIQKCHIEDLDFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLP
QLPHFRVESFSEDEWNLLYVAVTRAKKRLVMTKSLENILTLAGEYFLQAELTSSVLKTGV
VRCCVGQCSNAIPVDTALTMRKLPITYSNRKENRGGYLCHSCAEQRIGPLAFLTASPEQV
HAMERTVENLVLPRHEALLFLVF
Download sequence
Identical sequences H0XDT8
ENSOGAP00000014052 ENSOGAP00000014052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]