SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014143 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000014143
Domain Number - Region: 60-106
Classification Level Classification E-value
Superfamily E set domains 0.0252
Family RhoGDI-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014143   Gene: ENSOGAG00000015786   Transcript: ENSOGAT00000015796
Sequence length 1159
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:5586232:5651042:1 gene:ENSOGAG00000015786 transcript:ENSOGAT00000015796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDFLAENNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRADQQKYGDIIFDFSY
FKGPELWESKLEAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLEDLNEGV
YIQQTLESVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSAD
SNMDDICKLLRSTGYSSQPGAKRPPNYPESYFQRVPINESFISMVIGRLRSDDIYNQVSA
YPLPEHRSTALANQAAMLYVILYFDPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNL
ADAWEPYKAAKTALNNTLDLSNVREQASRYATVSERIHAQVLQFLKEGYLREEMVLDNIP
RLLNCLRDCNVAIRWLMLHTADSAYDPNNKRLRQIKDQILTDSRYNPKILFQLLLDTAQF
EFILKEMFKQMLSEKQTKWEYYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREIS
KQISSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINI
KEEVLITMQIVGDLSYAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRI
NQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDK
LRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAF
ALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINY
NVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDPKMTCHI
DQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIIL
RDKTVQETLKTLMNAVSPLKSIVANSNKIYFSAIAKTQKIWTAYLDAIMKVGQMQILRQQ
IANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDPSLPYPKEDNTLLYEITAYLEAA
GIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPADPVDWPPLVLGL
LTLLKQFHSRYTEQFLALIGQFIRSTVEQCTSQKIPEMPADVVGALLFLEDYVRYTKLPR
RVAEAHVPNFIFDEFRTVL
Download sequence
Identical sequences H0XE08
XP_003782395.1.62490 ENSOGAP00000014143 ENSOGAP00000014143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]