SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014151 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014151
Domain Number 1 Region: 2043-2235,2287-2470,2504-2559
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-107
Family DNA polymerase I 0.0000012
Further Details:      
 
Domain Number 2 Region: 106-274,307-362,412-500
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.41e-43
Family Tandem AAA-ATPase domain 0.00036
Further Details:      
 
Domain Number 3 Region: 664-837
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.23e-42
Family Achaeal helicase C-terminal domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1874-2007
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000936
Family DnaQ-like 3'-5' exonuclease 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000014151
Domain Number - Region: 532-620
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00122
Family RecQ helicase DNA-binding domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014151   Gene: ENSOGAG00000015795   Transcript: ENSOGAT00000015804
Sequence length 2563
Comment pep:known_by_projection scaffold:OtoGar3:GL873608.1:4300056:4428515:1 gene:ENSOGAG00000015795 transcript:ENSOGAT00000015804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPRPGGKRRRSPSSSDSFPGSGGDSSVSPQFLSGSVLSPPPGLGRCLNGRRRQSKGEC
KQTVPDDQIDKLLLANWGLPTAVLEKYHSFGVKKMFQWQAECLLLGQVLEGKNLVYSAPT
SAGKTLVAELLILKRVLEMRKKVLFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTSP
TGRFSSLDVAVCTIERANGLINRLIEENKMNLLGMVVVDELHMLGDSHRGYLLELLLTKI
CYITQKSASCQSDLASPLTNAVQIVGMSATLPNLDLVASWLNAELYHTNFRPVPLLESVK
IGNSLYDSSMKLVREFQPILQVKGDEDHVVNLCYETICDNHSVLLFCPSKKWCEKLADTI
AREFYNLHHQAQGLVKPSEFPPVMLEQKDLLEVMDQLRRLPSGLDSVLQKTVPWGVAFHH
AGLTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFGGRPLDVLTYKQM
VGRAGRKGVDTVGESILVCKNAEKSKGMALLQGSLKPVRSCLQRREGEEVTASMIRAILE
IIVGGVASTSEDMQTYASCTFLAASMKKGKQGIQRNQDSVQLGAIEACVMWLLENEFIQM
TEASDGTEGKVYHPTHLGSATLSSSLSPTDTLDIFADLQRAMKGFVLENDLHIVYLVTPM
FEDWTVIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHK
RFFTSLVLLDLISEVPLKEINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLGWHNMELL
LSQFQKRLTFGVQRELCDLVRVSLLNAQRARALYASGFLTVADLARANIAEVEVVLKNAV
PFKSARKAIDEDEEAVEERRNMRTIWVTGRRGLTEREAAALIVEEAKMILQQDLVEMGVQ
WDPSFLLNSGTHSSTSSESQGKEHAFTPQTKSSCKRVTLRSKSNRIFGDSYVKHSPNIVQ
DLDKSREHTSSFYYSFQSRNQEHQTNPIFRARKRASLDINKDKIVTSLNDRKTSTKKVVQ
IFSSEKTKKESFRSQKHSKHLKQIRNSSPLNDSRIYKVDFQGQTLFSPIVCEEPFTLDKK
NTEFKNSGPFAKNVSFCAGEKYNKTSFLSQVKQSCSRDRIITNDILLEHFITESQSKISE
NGRGLAVVETEKINEVLQQNDPENQNVYVKHHDIYSDNHRPEKQSNKQANSYTKEKKGDR
QMSCEVFSSHLNRDSDFTATKCENIEVNTEEKNPNDFRALGENTNKNEIPSGILISTGTF
GKSGGQHENFLNVPGIQEKTDTYATNKTSNHHVSDLGLVRGDFEDSFYLGTQSEKIIQQT
ATEITKQETKDTNLAAVISFQNAFHATFPGERHSSGRTDGDHLNLKSIRTMKQSTDSHGV
DILSPENPVFRSPMLLEENALCFKGSELSVTDSQLNSFLQGYQTQEAVKPVIPLVPQQKT
PTDTEGECVQVPETSLNMSDSLLFDSFSEDYLVKAQPTDVQAKEPLPSQIPSDHFSDSPS
LQQEDLIKNSNVNESEDIQEQSPCFSDQSVMFSEMNSLQMVEDLDNEGLFSAQEKDNTIV
SLRALELSDPVIVGNDHPQEVTGGDGGERTHKSKLTGTGQNHSFMWSGASFDLSPGLQRI
LDKVPSPPKNEELKLATINLSGLKGKSTELNEKQEAVSNMETNQVQGFSCSPNEVKSKQE
TPENSVKCGETSPFLPCKQNCVADDNGLIPPTPTPASASKLAFPEILGAPIECWKTGGVL
QPGESYSFGSPSDIKNQDLNLENRSDFKDGSPMRDTSFSLLSSQDGLQLTPAASNSESLA
IIDVASNQALFETFIKEWQYKKRFSISVACEKIRSSASSKTATIGGRFKQASLPQEPPAR
EDGFSVKGYDDMLVVGLAICWGRRDAYYISLQKEQKHSEISASLVPPSLDPSLTVRDRMW
HLQSCLQKESDKERSVVIYDFIQTYKILLLSCGISLEQGYEDPKVACWLLDPDSKEPTLH
SIVTSFLPHELPLLEGLETGQGIQSLGLNVSAEHSGRYRASVESILIFNSMNQLNSLLQK
ENLQDVFRKVEMPSQYCLALLELNGIGFSTAECESQKHIMQAKLDAIETQACQLAGHSFS
FTSSDDIAEVLFLELKLPPNGEMKNQCSKKTLGSTRRGNDKGCKLRLGRQFSTSKDVLNK
LKALHPLPGLILEWRRITNAITKVIFPLQREKRLNPFLGMERIYPVSQSHTATGRITFTE
PNIQNVPRDFEIKMPTLVGESPPSQALGKGLFPMGRRQNKGCGLKHGRQAQMEEKAADRG
MPFSVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDHRLIQVLNTGADVFRSIAAEWK
MIEPESVGDDLRQQAKQICYGIIYGMGAKALGEQMDINENDAACYIDSFKSRYKGINHFM
SETVKNCKRDGFVQTILGRRRYLPGIKDNNPYHKAHAERQAINTKVQGSAADIVKIATVN
IQKQLEAFQSTFKSHGHRESMLQNDRTGLLAKRKLQGMFCPIRGGFFILQLHDELLYEVA
EEDVVQPKLSEKNEMENAIKLSVKLKVKVKIGSSWGELKDFDV
Download sequence
Identical sequences H0XE15
ENSOGAP00000014151 ENSOGAP00000014151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]