SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014197 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014197
Domain Number 1 Region: 1213-1435
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-63
Family DBL homology domain (DH-domain) 0.00000000275
Further Details:      
 
Domain Number 2 Region: 1435-1575
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-32
Family Pleckstrin-homology domain (PH domain) 0.000000201
Further Details:      
 
Domain Number 3 Region: 210-309
Classification Level Classification E-value
Superfamily EF-hand 5.78e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 1141-1214
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-26
Family SH3-domain 0.0000619
Further Details:      
 
Domain Number 5 Region: 1589-1709
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.21e-26
Family PLC-like (P variant) 0.011
Further Details:      
 
Domain Number 6 Region: 6-105
Classification Level Classification E-value
Superfamily EF-hand 5.74e-26
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 7 Region: 740-812
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-19
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 8 Region: 993-1055
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-19
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 9 Region: 908-970
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-19
Family SH3-domain 0.0000935
Further Details:      
 
Domain Number 10 Region: 1069-1139
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-18
Family SH3-domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014197   Gene: ENSOGAG00000015839   Transcript: ENSOGAT00000015853
Sequence length 1716
Comment pep:known_by_projection scaffold:OtoGar3:GL873630.1:1960743:2128055:-1 gene:ENSOGAG00000015839 transcript:ENSOGAT00000015853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGNLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSTLPPVMKQQPVAISSAPAFGMGGM
GSMPPLTAVAPVPMGSIPVVGMSPPLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASAPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVISSTSADQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKNQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLLTLKRALEAKELARQQLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHNKQQLQKQKSIEAERLKQKEQERKIIELEKQKEEAQRRAQERDRQW
LEHVQQDEEHQRPRKLHDEERQKREESVKKKDGEEKGRPEVQDKLGRLFHQHQEPAKPAI
QAPWSTTEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVDESQTGEPGWL
GGELKGKTGWFPANYAEKIPENEVPAPVKPVTDLTSAPAPKLALRETPAPLAVTSSEPST
TPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPGAGQLRQRSAFTPATATGSSPSP
VLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSY
VKLVSGPVRKSTSMESGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQ
GDVILVTKKDGDWWTGTVGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASY
TATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITP
TEPPKSAALPAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGLFP
SNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQK
PLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPH
MQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDLRCKGMPLSSFILKPMQRVTRY
PLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGL
SEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVF
SPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQK
IKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTM
GSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCVTVFERDQFSPDDFLGRTEIRVADI
KKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences H0XE46
ENSOGAP00000014197 ENSOGAP00000014197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]