SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014224 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014224
Domain Number 1 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 2 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 645-714
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000958
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 5 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000116
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 703-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000162
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014224   Gene: ENSOGAG00000015874   Transcript: ENSOGAT00000015882
Sequence length 878
Comment pep:known_by_projection scaffold:OtoGar3:GL873582.1:8542620:8596780:-1 gene:ENSOGAG00000015874 transcript:ENSOGAT00000015882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGHSILYFILLSALIDKGHTCFCDRYSWTQWSSCSKTCNSGTQSRHRQIVVDQYYQDNF
CDQICTKQETRECNWQTCPINCLLGDYGPWSDCDPCLAKQSRVRSVLRPRQFGGQPCTEP
LVTFQPCIPSKLCKIEEVDCKNKFRCDSGRCIARKLECNGENDCGDNSDERGCGRPKAVC
PRQYNPIPSVQLMGAGFHFLAREPRGEVLDNSFTGGICKTVKSSRASNPYRVPANLENVN
FEVQTEEDDLETDFYRDLTSFKQNEDQGASSLREDENSFHVPILFSSKKSQKSDHNSAFK
EAIQASHKKDSNFIRIHKVIKVLNFTMKSNDLRLSDVFLKALNHLPLEYNYALYSRIFDD
FGTHYFTSGSLGGTYDLLYQFSREELQNSGLTEEESKTCVRIETKKRFLFFTKTKVKHRC
TTNKLSEKHEGSFLQGAEKAISLVQGGRSEYAAALAWEKGSSGPEEKVFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRSNLRKAFREYAAKFDPCQCAPCPNNGRPALSGTECL
CVCQSGTYGENCERRSPDYKSDAVDGNWGCWSSWSTCDTTYKRWRTRECNNPAPQRGGKP
CAGEKRQEEDCTFSIMESNNYKIVLRNALSFFHLEFPGDVFIPDCPRPRLPSPCDNVFFK
NEKKLYTVGEEVEISCLTGFKAVGYQYFRCLPDSTWRRGDVECQRTECLVPAVPEVLTLT
PFQRLYKIGESIQLTCPKGFAVAGPSRYTCSGTSWTPPISSSLTCEKDILTKLKGHCEPG
QKQSGSECICMSPEEDCSYNSEDLCVFDIDTNHYFTSSACKFLAEKCLNNQKLHFLHIGS
CQEGPPLDWGLERTELSSNSTKKESCGYDTCYDWEKCS
Download sequence
Identical sequences H0XE70
ENSOGAP00000014224 ENSOGAP00000014224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]