SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014252 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014252
Domain Number 1 Region: 1871-2116
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-53
Family Ankyrin repeat 0.000000058
Further Details:      
 
Domain Number 2 Region: 452-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000522
Family EGF-type module 0.00045
Further Details:      
 
Domain Number 3 Region: 591-720
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000068
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 970-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000146
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 5 Region: 528-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000292
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 6 Region: 1170-1311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 408-532
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000957
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 754-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000115
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 856-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000867
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1146-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000205
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 177-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000675
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 14 Region: 219-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000675
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 15 Region: 295-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 16 Region: 257-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 712-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.008
Further Details:      
 
Domain Number 18 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000062
Family EGF-type module 0.012
Further Details:      
 
Domain Number 19 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000692
Family EGF-type module 0.015
Further Details:      
 
Domain Number 20 Region: 332-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000985
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 21 Region: 1529-1561
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0043
Further Details:      
 
Domain Number 22 Region: 60-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.015
Further Details:      
 
Domain Number 23 Region: 1489-1522
Classification Level Classification E-value
Superfamily Notch domain 0.00000034
Family Notch domain 0.0056
Further Details:      
 
Domain Number 24 Region: 1448-1480
Classification Level Classification E-value
Superfamily Notch domain 0.000000981
Family Notch domain 0.00025
Further Details:      
 
Domain Number 25 Region: 1390-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family EGF-type module 0.025
Further Details:      
 
Domain Number 26 Region: 1113-1150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000237
Family EGF-type module 0.018
Further Details:      
 
Domain Number 27 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000351
Family EGF-type module 0.057
Further Details:      
 
Domain Number 28 Region: 1345-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000765
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000014252
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00048
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 832-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0163
Family EGF-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014252   Gene: ENSOGAG00000015908   Transcript: ENSOGAT00000015915
Sequence length 2550
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:2169240:2211665:-1 gene:ENSOGAG00000015908 transcript:ENSOGAT00000015915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLAPLLCLALLPALGARGLRCSQPSETCLNGGKCEVVNGTEACVCNGAFVGLRCQDP
SPCLSSPCKNAGTCHVVDRRGVADYTCSCLLGFSGPLCLTPLNNACLTNPCRNGGTCDLV
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPATFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEVGSYRCACRATHTGPNCELPYVPCSPSPCQNGGTCRPTGDVT
HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGSYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA
NPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP
GYEGVHCEVNTDECASSPCLHGGRCLDKINEFQCACPTGFTGHLCQYDVDECASTPCRNG
AKCLDGPNAYVCVCAEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNVNECYSQPCRHGGTCQDRDNSYLCFCLKGTTGPNCEINLDDCASSPCEAGTCVDKID
GYECVCEPGYTGSVCNIDIDECAGSPCHNGGTCEDGVNGFTCRCPDGYHDPTCLSEVNEC
NSNPCIHGTCRDSLNGYKCDCDPGWSGANCDVNNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDGVAGYRCNCLLPYTGATCEAVLAPCAPSPCRN
SGECRESEDFESFSCICPTGWQGQTCEIDVNECVKSPCQHGASCQNTNGSYRCHCQAGYT
GPHCEADLDDCQPNPCHNGGSCTDGVNTAFCDCLPGFQGAFCEEDINECASNPCRNGANC
TDCVDSYTCTCPTGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPSGFTGSYCQH
DINECDSRPCLHGGTCQDSCGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTHTS
YRCECPSGWTGLYCDVPSVSCEVAARQRGVDIAHLCQHGGLCVNEGNTHHCRCQAGYTGS
YCEDLVDECLPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEVNECLSHPCQNGGTCLD
LINTYKCSCPRGTQGVHCEINVDDCSPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCQNGG
TCAVASNTARGFICRCPAGFEGATCENDARACGGLRCLHGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCLNGNPCYNQGSCEPIPESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI
PPPQIEEACKLPECQEDAGDKVCNPQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWLYF
SDGRCDPQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLTPPEQLRNNSLHFLRELSRVLHTNVVFKRDAHGRLMIFPYY
GREEELRKHPVKRAAGGWAAPSTLLGQATASLFPGGGGVRRRRELDPMDIRGSIVYLEID
NRQCVQSSSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPAPAQLHLMYVVA
AAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNTS
DRALMDDNQNEWGDEDLETRKFRFEEPVALPELDDQTDHRQWTQQHLDAADLRVSAMAPT
PPQGEAHTDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLH
NQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILI
RNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNV
DAAIVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIA
QERMHHDIVRLLDEHNLVRSPPLHGAGLGPAPTLSPPLCSPNGYLGNLKPSMQGKKARKP
STKGLVCGGKEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPS
PFQQSPSMPLNHLPGMPDTHLGVGHLNVAAKPEMAALGTGGRLAFEAGPPRLSHLPVASG
TSSILGSANSGGAMNFSVGGAASLNGQCEWLSRLQNGMVPSQYNPLRGSVAPSTLSAQGP
SLQHSLMGPLPSGLAANTLTQMMSYQGLPSTRLATQPHLGQTPQVQQQNLQMQQQNLQPP
NIQQQQQNLQPHLGVGSAAGSHLGRSFLGGEPSQADVQSLGPGSLTVHTVLPPEGLAPPT
SLPSSLAPPMTTAQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSP
HSNVSDWSEGVSSPPTSMQSQVAHIPEAFK
Download sequence
Identical sequences H0XE93
ENSOGAP00000014252 XP_003794898.1.62490 ENSOGAP00000014252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]