SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014272 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014272
Domain Number 1 Region: 57-82,127-163
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000106
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 166-209
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000405
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014272   Gene: ENSOGAG00000015934   Transcript: ENSOGAT00000015939
Sequence length 326
Comment pep:known_by_projection scaffold:OtoGar3:GL873580.1:2497558:2499460:-1 gene:ENSOGAG00000015934 transcript:ENSOGAT00000015939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKLKERKVSPLSLTGVCALVIEASDSSSCRLARRMAGKWPHGTLSAQKSQVRTPVSHK
VIEKRRRDRINRCLNELGKTVPMALAKQVIRQSWRAQRVFLIRALRAKRALGPAPCVWDR
CEKSVLLLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKELLAEFANYFHYGYHECMK
NLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLALLPEPDFNYQLHPAGTEF
SGHSPGEAAVFPQGATQGPFPWPSGAARSPALPYLPSAPVQLQSPAQQHSPFLAPMQGLD
RHYLNLIGHAHPNALNLHTSQHPSVL
Download sequence
Identical sequences H0XEA8
ENSOGAP00000014272 ENSOGAP00000014272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]