SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014321 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014321
Domain Number 1 Region: 227-523
Classification Level Classification E-value
Superfamily RNI-like 1.8e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 
Domain Number 2 Region: 48-312
Classification Level Classification E-value
Superfamily RNI-like 1.26e-31
Family Cyclin A/CDK2-associated p19, Skp2 0.0061
Further Details:      
 
Domain Number 3 Region: 2-41
Classification Level Classification E-value
Superfamily F-box domain 0.00000719
Family F-box domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014321   Gene: ENSOGAG00000015993   Transcript: ENSOGAT00000015998
Sequence length 576
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:5556522:5698015:1 gene:ENSOGAG00000015993 transcript:ENSOGAT00000015998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQIFFYLSLRDTVVCSQISHAWLSMTQMSSLWNAIDFSAVKNIITEKYVVSTLQKWRLN
VLRLNFRGCLFRPKTFKSVSACKNLQELNVSDCSTLTDESMRQISEGCPGVLYLNLSNTN
ITNRTMRLLPRYFHNLQNLSLAYCRKFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGF
KNIASSCSGIMHLTINDMPTLTDNCVKALVEKCLRITSVIFIGAPHISDSTFKALSICSL
RKIRFEGNKRITDTCFKLMDKNYPNISHIYMADCKGITDSSLKPLSHLRRLTVLNLANCM
RIGDIGIKHFLDGPASISIRELNLSNCVQLTDFSAMKLSDRCYNLNYLSLRNCEHLTDGG
LEYIVNILSLVSVDLSGTKISDEGLLILSKHKKLKELSLSECYKITDIGIQAFCRFSLTL
EYLDVSYCSRLSDGIIKALAIYCTDITSLIIAGCPKITDSGIEMLSAKCHYVHILDVSGC
VLLTDQMLQSLQIGCKQLRILKMQYCGRISKEAALKMSSIVQQQEYSSNDPPRWFGYDSE
GKTLKVNQEMKPPKSSQDAGEMTVKRSIVSNEEEEV
Download sequence
Identical sequences H0XEF1
ENSOGAP00000014321 ENSOGAP00000014321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]