SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014357 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014357
Domain Number 1 Region: 74-260
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.09e-71
Family T-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 2424-2504
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000837
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014357   Gene: ENSOGAG00000016028   Transcript: ENSOGAT00000016041
Sequence length 3066
Comment pep:known_by_projection scaffold:OtoGar3:GL873569.1:8512337:8613186:1 gene:ENSOGAG00000016028 transcript:ENSOGAT00000016041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKQQIILANQDGGTVGGAAPTFFVILKQPGNGKTDQGILVTNRDACALASSVSSPGKP
KGKICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNLK
YILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLK
LTNNTLDQEGHIILHSMHRYLPRLHLVPAEKATEVIQLNGPGVHTFTFPQTEFFAVTAYQ
NIQITQLKIDYNPFAKGFRDDGLNSKPQRDGKQKNSSDQEGNSVPSSPGHRVRLGEGEGS
EIQPGDLDPISRGHETSGKGLEKTLLNINQDFLGFVDNDSALEVPQLKQEVSESLVANNF
EDGSRIVSSLDPNGNFNVVIKEEPLDDYDYEVGECPDGVTIKQEETDEETDVYSNSDDDP
ILEKQLKRHNKVDNLEGDHLSSKWLPSSPSGVAKAKMFKLDSGKMPVVYLEPCAVTKSTV
KISELPDNMLSTSRKDKSSVLAELEYLPTYIENSSGTGFCLGKESENGLERHSPDLRVVQ
KYPLLKDPQWKYPDKSDSISTERILDSSKGSTGDSHSEKEELGKKRTTLLKIAATTKAVN
ANQNVSPNVPGKRGRPRKLKLSKAGRPPKNTGKSLTTTKNTPVGPGTTFPDVKPDLEDVD
GVLFVSFESKEALDIHAVDGTTEEPSSLQASTTNDPGCRTRIFQLEKELIEDLKSLRHKQ
VIHPGLQEVGLKLNSVDPTMSIDLKYLGVQLPLAPATSLPFWNLTGTNPASPDAGFPFVS
RTGKTNDFTKIKGWRGKFHSASASRNEGGNPESSLKNRSAFCSDKLDEYLENEGKLMETS
MGFSSNAPTSPVVYQLPTKSTSYVRTLDSVLKKQSTISPSTSYSLKPHSVAPASRKARSQ
NKQATLSGRAKSSYKSILPYPVSPKQKNSHMILGDKVTKNFSSTISENQVNNFVVPTLDE
NVFPKQISLRQAQQQQQQQHQGTRPPGLSKSQVKLMDLEDCALWEGKPRTYITEERADVS
LTTLLTAQASLKTKPIHTIIRKRAPPCNNDFCRLGCVCSSLALEKRQPAHCRRPDCMFGC
TCLKRKVVLVKGGSKTKHFQRKATHRDPVFHDTLGEEAKEEEGGVREEEEQLKDKKKRKK
VEYTICETEPEQPVRHYPLWVKVEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLSTTVKG
KLLTGIKPARAYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYERKREEQRQPSPSPSP
PPSFQQQSSCHSSPQNCTVKEPDSEQQPLKQLTCDLEDDSDKSQEKSWKSSCNEGESSSA
SYMHQRSPGGPTKLIEIISDCNWEEDRNKILSILSQHINSNMPQSLKVGSFIIELASQRK
SRGEKNPPVYSSRVKISMPSCQDQDDMAEKSGSETPDGPLSPGKMDDISPVQTDVLDSVR
ERLHGGKGLPFYAGLSPAGKLVAYKRKPSSSTSGLIQVASNAKVAASRKPRTLLPSTSNS
KMASSSGTATNRPGKNLKAFVSAKRPIAARPSPGGVFTQFVMSKVGALQQKIPGVSTPQP
LTGPQKFSIRPSPVMVVTPMVSSEPVQVCSPVTAAVTTTPQVFLENVTAVTPMTAISDVE
TKETTYSSGATTSGVVEVSETNTSTPVTSTQSTATVNLTKTTGITTPVASVAFPKSLVAS
PPTITLPVASTASTSIVVMTTAASSSMVTTPTSSLGSVPIIISGINGSPPVSQRPENAPQ
IPVATSQVSSNTVKRPGPRLLLIPVQQGPPTLRPVPNTQLQGHRMVLQPVRSPSGMNLFR
HPNGQIVQLLPLHQIRGSNTQPNLQPVMFRNPGSVMGIRLPAPSKPSETPPSSTSSSAIS
VMNPVIQAVGSSPAVNVITQAPSLVSSGPSFVSQAGTLTLRISPPEPQSFASKTGSETKI
TYSSGGQPVGTASLIPLQSGSFALLQLPGQKPVPSSILQHVASLQMKRESQNADQKDETN
SIKIEQETKKNLHSGETVDPEANTIKQNSGGLASGETLNESLEDGGDHLDEESLAEDVPA
AVQPAVRSYITGSRTSENYKDVNEEFETRNHNSPKEKLTVIEFRTISEKTSNKTVQNANK
VQFQKFGDVKVEQQKGLDNAEEKSNEFPVISKERCKRESSGSKVVEQQSNSQSEAKEKGR
GDSVEKNGIRERWRKHLKGPLTRKCVRTSQECKKEVDEQLIKETKTCQENLDVFQQEPGI
SDLLGKSITTENARVLKTECDSWSTISNPPALSIGPRRATKGSRGSGRFQGHLLLSGEQI
KLKQEKKGGRSSADFTVLDLEEDDEEDENEKTDDSIDEIVDVVSDYQSEEVDDIEKNNCV
EYIEDDEEQVDIETVEEFSDEISVAHMKTTAAHTQSFRQQCRTHSSTDEKATERSRKAPP
IPVKLKSEYWSDKLQKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKTTLGLLHSSKVSK
SLILTRAFSEIQGLTDQADKLIGQKNLLTRKRNILIRKVSSLSGKTEEVVLKKLEYIYAK
QQALEAQKRKKKMGSDEFDVSPRTSKQQEGSSASSVDLEQMFINNRRGKPLILSRKRDQA
KENTSPSNTPHTSANLVMTPQGQLLTLKGPLFSGPVVTVSPGLLDADLKPQVGSSAMAQS
ENDDLFMMPRIVNVTSLATDGGLVGIGGNKYPHEVPDGKPPDHLTDTVRNENNSLEDSGI
ISSRGNHRDSRKTLGSTQVFLANKDSGFPQIVDVSSMQETQDFLPKKISGDVRGIQYKWK
ENESRGERMKSKESSFHKLKMKDLKDSSIEMELRKVTSAIEEAALDSGELLTNMEDEDDT
DDTLTSLLNEIAFLNQQLNDDSVSLAELPSTVDTEFPGDARRAFISKLAPGNSTTFQVGH
LGTGLKELPDVQEESDSISPLLLHLEDDDFSENEKQLVEPSSEPDVLKIVIDPEIKDSLL
SHRKTSDEGKSTSDLPAESENVSSPPILHMRTGLENSSSTDTLWRPMPKLAPLGLKVANP
SNDADGQSLKVMPCLAPIAAKVGSVGHKISLTGNDQEVRESKVMPTLAPVVAKLGSSGAS
PSSAGK
Download sequence
Identical sequences H0XEI2
ENSOGAP00000014357 ENSOGAP00000014357 XP_012661817.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]