SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014360 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014360
Domain Number 1 Region: 401-696
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.2e-79
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-34
Family Spermadhesin, CUB domain 0.0000146
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-31
Family Spermadhesin, CUB domain 0.0000276
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000723
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014360   Gene: ENSOGAG00000016044   Transcript: ENSOGAT00000016045
Sequence length 699
Comment pep:known_by_projection scaffold:OtoGar3:GL873579.1:9436941:9499569:1 gene:ENSOGAG00000016044 transcript:ENSOGAT00000016045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSFLLPSTXLCCFLPKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPEGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGKETTDTEQTPGQEVVLSPGSFMSVTFRS
DFSNEERFTGFDAHYVAVDVDECKEREDEELSCDHHCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECFYSIELEEGFMVSLQFEDIFDIEDHPEV
PCPYDYIKIKAGPKVLGPFCGEKAPEPINTQTHSVQILFRSDSSGENRGWQLSYRAAGNE
CPELQPPVHGKIEPVQAKYSFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNRIP
TCKIVDCGAPAGLEHGLVIFSTRNNLTTYKSEVTYSCQQPYYKMLPNITGIYSCSAQGIW
MNKVLEKSLPTCLPVCGLPKFSRKLMARIFNGRPVQRGTTPWIAMLSQPNGQPFCGGSLL
GTSWIVTAAHCLHHSPDPEDPTLQDTDLLSPYDFQIIMGKHWRIRSDESEQYLRVKRIIL
HPLYNPQTFENDVALVELLDSPTLNPFVMPICLPEGDPQEGAIVIVSGWGKQFLQRFPET
LMEIEIPIVDHHTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLDRERGQW
YLVGTVSWGVDCGKKDRYGVYSYIHHHKGWIQSVTGVRN
Download sequence
Identical sequences H0XEI4
ENSOGAP00000014360 ENSOGAP00000014360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]