SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014540 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014540
Domain Number 1 Region: 432-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.58e-54
Family Eukaryotic proteases 0.0011
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 3 Region: 297-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000059
Family EGF-type module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014540   Gene: ENSOGAG00000016246   Transcript: ENSOGAT00000016248
Sequence length 737
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:62187806:62260306:-1 gene:ENSOGAG00000016246 transcript:ENSOGAT00000016248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGRWAQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECICPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRTPKGQILLESYPLNAHCEWTIHAKPGFIIQLRFVMLSLEFDYMCQYD
YVEVRDGDNSDGPIIKRVCGNERPAPIQSTGSSLHVLFHSDGSKNFDGFHAIFEEITACS
SSPCLHDGTCFLDKAGSYKCACLAGYTGQQCENLLEAGKSKIKATEDSLSVLEERNCSDP
GGPVNGYKKITGGPGLISGSYVKIGTVLSFFCNNSYVLSGNEKRTCQQDGEWSGKQPICI
KACREPKISDLVRRKVLPMQIQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLPSGY
QHLHTQLQYECISPFYHRLGSSRRTCLRTGKWSGRAPSCIPICGKIENVTSPKTQGTRWP
WQVAVYRRTSGVHDGSLHKGEWVLVCSGALVNERTVVVAAHCVTDLGKVTVIKTVDLKVV
LGKFYRDDDRDEKTIQSLRISAVILYPNYDPILLDADIAILKLLDKARISTHVQPICLAA
PRDLSTAFQESRITVAGWNVLADVRSPGFKNDTLHSGVVSVVDSLLCEEQHEDHGVPVSV
TDNMFCASRDPTAPSNICTADTGGIAAMSFPGRGSPEPRWHLVGLVSWSYDRACSHSLST
AFTKVLPFKDWIERNMK
Download sequence
Identical sequences H0XEY4
ENSOGAP00000014540 ENSOGAP00000014540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]