SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014637 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014637
Domain Number 1 Region: 399-618
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.46e-51
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 609-739
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000669
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014637   Gene: ENSOGAG00000016350   Transcript: ENSOGAT00000016356
Sequence length 841
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:10929152:10938026:-1 gene:ENSOGAG00000016350 transcript:ENSOGAT00000016356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSLPAATPPTQKPPRIIRPRPPSRPRAAQFPGPPHNGSSPQELPQTVNDAPTLMCTP
IFWEPPAASLKSPALLPPSASRTSLDSQTFPDSASGTPSPVSRRSISPEPAPRSPVPPPK
PSGSPHTPLPLLPTARDLVKDGSASAPGTVRRLAGRFEWGAEGRAQAAEALEPGPQGGAN
VNGEREVPLTGSGSQENGAPDAVLACPPCCPCVCHAARPGLELRWVPVGVKEEGSRAPCR
ASPLRTSRSRPNPPSISHPPVVLTSYRSTAEHNVLPPLKPPKPSRVRQDTTISGDPPQPD
LDLPSEDGIPTGDSPDETPQNVPPATMEGRDEEGLEGLKEQNWELPLQDEPLYQTYRAAV
LSEELWGVGEDGGPSPASAGEAPTFARPPGPRNTLWQELPAVRASGLLDTLSSHERRMQE
SLFEVVTSEASYLRSLRLLTDTFVLSQPLRDTLTPRDHHTLFSNVQRVQGVSERFLGALL
SRVRSSPHISDLCDVVHTHAVGPFSVYVDYVRNQQYQEETYSRLMDTNMRFSAELRRLQS
LPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALGAVSKIIERCSA
EVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLELQGELTELGCRRGGVLFTSRPRFT
PLCLLLFSDLLLIAQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRPT
HRLLQASSLSDMQRWLGAFPTPGPLPCSPDTIYEDCDCSQELCSELSTPSKTEGQSLESR
AAPKHLHKSPEGWLKGLPGAFPAQLVCEVTGEHERRKHLRKHQRLLEAAGPSSGIPSAPP
P
Download sequence
Identical sequences H0XF63
ENSOGAP00000014637 ENSOGAP00000014637 XP_003791157.1.62490 XP_012661411.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]