SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014649 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014649
Domain Number 1 Region: 50-188
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.37e-38
Family Regulator of G-protein signaling, RGS 0.0000935
Further Details:      
 
Domain Number 2 Region: 358-449
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-31
Family Ras-binding domain, RBD 0.0000701
Further Details:      
 
Domain Number 3 Region: 303-371
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-19
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014649   Gene: ENSOGAG00000016361   Transcript: ENSOGAT00000016368
Sequence length 567
Comment pep:known_by_projection scaffold:OtoGar3:GL873780.1:206405:221254:1 gene:ENSOGAG00000016361 transcript:ENSOGAT00000016368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKPKHLGVPNGRMVLAVSDGELNNTTGAQGQGQGRGSSLSIHSLPSGPSSPFPTEEQP
VASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARN
IYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
RECLLAEAEGRPLRKPSSSHLGSPDSTRKKPKLKPGKSLPLGVEELGQLPPAEGPAGRQL
RKSFRRELAGGATNSALRRESQGSLNSSASLDLGFLAFVSNKSESHRKSLGSTEGESESR
PGKYCCVYLPDGTASLALARPGFTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQEC
TVLADQEVRLENRITFELELAALERVVRISAKPTKRLQDALQPILEKHGLSPQQVALHRP
GEKQPLDLKKLVSSVAAQRLVLNTCPGRECWPSCGSDPTFLQGCLPRTQDKATHPPSVPP
NSVVKLSGSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPS
SQEAPPQTESAAQPIGGALNSTAHPAL
Download sequence
Identical sequences H0XF73
ENSOGAP00000014649 ENSOGAP00000014649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]