SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014671 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014671
Domain Number 1 Region: 485-717
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.8e-36
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Domain Number 2 Region: 1471-1711
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-33
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 1150-1308,1345-1422
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 95-251,296-366
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.55e-32
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000014671
Domain Number - Region: 1708-1755
Classification Level Classification E-value
Superfamily EF-hand 0.0479
Family Calmodulin-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014671   Gene: ENSOGAG00000016377   Transcript: ENSOGAT00000016395
Sequence length 2336
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:12857:233833:-1 gene:ENSOGAG00000016377 transcript:ENSOGAT00000016395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRFGDELGGRYGGAGGGERARGGGAGGAGGPGPGGLQPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPHTPFEYMILATIIANCIVLALEQH
LPDGDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTG
ILATAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMF
AIIGLEFYMGKFHKACFPNSTDTDPVGDFPCGKEPPARLCEGDTECREYWPGPNFGITNF
DNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSG
EFAKERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDRNAEEKSPLDAVL
KRAAAKKSRNDLIHAEEGEDRFADLCAVGSPFARASLKSGKTESSSYFRRKEKLFRFFIR
RVVKAQSFYWAVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGL
GPRSYFRSSFNCFDFGVIVGSIFEVVWAAIKPGASFGISVLRALRLLRIFKVTKYWSSLR
NLVVSLLNSMKSIVSLLFLLFLFIVVFALLGMQLFGGQFNFKDETPTTNFDTFPAAILTV
FQILTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQ
ELTKDEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAARQQNSAKARSVWEQRASQLR
LQNLRASCEALYSELDPEERLRFATTRHLRPDMKTHLDRPLVVELGRDGPRAPPGGKARP
EATDATEGADPPRRHHRHRDRDKAAAGEPDRADAPRAESGEPSARDERVRPHRSHSKEAA
GPPEARGERGRGPGPEGGRRHHRRGSLEEATDREPRRHRAHRHACDQGKEGSAPTAKGER
RSRHRGGPRAGPREAESGEEPARRHRTRHKVLPAQDAAVKEAPEKEAEVAEVDKEKELRN
HQPKELHCDLEASGTMGVGPVHTLPSTCLQKVEEQPEDADNQRNVTRMSSQPSDPSTTVH
IPVTLTGPPGETTVVSSGNVDPESQVEGKKEVEADDVMRSGPRPIVPYSSMFCLSPTNLL
RRLCHYIVTMRYFEMVILVVIALSSIALAAEDPVRTDSPRNNALKYMDYIFTGVFTFEMV
IKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKGKDINTIKSLRVLRVLRPL
KTIKRLPKLKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELE
RDCRGQYLDYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATY
EEQGPSPGYRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERAC
IDFAISAKPLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTAVLMMKFYDAPYEY
ELMLKCLNIVFTSMFSMECVLKIIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIANNF
INLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVF
GNIALDDDTSINRHNNFQTFLQALMLLFRSATGEAWHEIMLSCLSNRACDERASASECGS
DFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAAC
GRISYNDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISSEDMTVHFTSTLMALIRT
ALEIKLAPAGTKQHQCDAELRKEISVVWANLPQKTLDLLVPPHKPDEMTVGKVYAALMIF
DFYKQNKTTRDQIQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSN
GGAIQTQESGIKESVSWGTQRTQDTPCEAWAPLERGHSAEIPAMQPGVLAVDVQMQNMAM
RAPNGDPQPGLESQGRAASMPRLAAETQPVPDASPMKRSISTLAQRPHAAHLCSTALDRP
PPSQASHHHHHRCHRRRDKKQRPLEKGPSLSADVDGATGSAAGPGLPPGEGPASCRRERE
RRQERGRSQERRQPSSSSSEKQRFYSCDRFGGREPPKPKLSLSSHPTSPTAGQEPGPHPK
GSGSVNGSPLPSASGASTPGRGGRRQLPQTPPTPRPSVTYKTANSSPVHFSGAQTSLPAF
SPGRLSRGLSEHNALLQTDPLGPPLVPSSRIGSDPYLGQRLDSEASAHTLPEDTLTFEEA
LATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGRARHSYHHPDQDHWC
Download sequence
Identical sequences H0XF95
ENSOGAP00000014671 ENSOGAP00000014671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]