SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014694 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014694
Domain Number 1 Region: 1215-1370,1409-1488
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-40
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 767-914,948-995
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 126-271,360-429
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-31
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 1538-1655
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4e-20
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014694   Gene: ENSOGAG00000016402   Transcript: ENSOGAT00000016423
Sequence length 1656
Comment pep:known_by_projection scaffold:OtoGar3:GL873609.1:4994321:5074621:-1 gene:ENSOGAG00000016402 transcript:ENSOGAT00000016423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKNDDENGPKPNSDLEAGKNL
PFIYGDVPPGMVSEPLEDLDPYYVNKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIA
IKILVHSLFSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLE
DFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALI
QSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVQWPPTNASLEEHSIENNITVDYN
GTLVNETVVKFDWKSYIQDSRYHYFLEGFPDALLCGNSSDAGQCPEGYMCVKAGRNPNYG
YTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAV
VAMAYEEQNQATMEEAEQKEAEFQQMLEQLKKQQEAAQQAATVTASEHSREPSAAGRLSD
SSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDDDEFHKSESEDSIRRKGFRFSIEGN
RLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFEDN
ESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVLPANGKMHSSVDCNGVVSLVGGPSVPT
SPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHASMDFLEDPSQRQRAMSIASILT
NTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHIVNLVVMDPFVDLAITICIVLN
TLFMAMEHYPMTEHFNNVLAVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVT
LSLVELGLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIV
FIFAVVGMQLFGKSYKDCVCKISSDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCME
VAGQAMCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRIQK
GIDYVKRKIYEFIQQSFVRKQKILDEIKPLDDLNNRKDCMSNHTTEIGKDLDYLKDVNGT
TSGIGTGSSVEKYIIDESDYMSFIHNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESK
EKLNESSSSSEGSTVDIGAPAEEQPVVEPEEALEPEACFTEGCVQRFKCCQISVEEGRGK
QWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYI
FILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALR
PLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTG
DRFDITEVNNHSDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYAAV
DSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTE
EQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMVET
DDQSEYVTTILSRINLVFIVLFTGECVLKMISLRHYYFTIGWNIFDFVVVILSIVGMFLA
ELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRT
Download sequence
Identical sequences H0XFB5
ENSOGAP00000014694 ENSOGAP00000014694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]