SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014702 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014702
Domain Number 1 Region: 325-450
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.2e-48
Family ets domain 0.0000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014702   Gene: ENSOGAG00000016429   Transcript: ENSOGAT00000016432
Sequence length 469
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:31269992:31485469:-1 gene:ENSOGAG00000016429 transcript:ENSOGAT00000016432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STELRFAKSSRMDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQD
LSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSELGSACSQEQPF
KFSYGEKCLYNVSSLGSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPERAF
PAHLPPSQSIPDSSFPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQ
GFKQEYHDPVYEHNTMVGGAASQSFPPPLMIKQEPRDFAYDSGCMFEKGPRQFYDDTCVV
PEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEP
EEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPD
NQRPLLKTDMERHINEEDTVPLSHFDESVAYMPEGGCCNPHPYNEGYVY
Download sequence
Identical sequences H0XFC3
ENSOGAP00000014702 ENSOGAP00000014702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]