SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014735 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014735
Domain Number 1 Region: 647-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-36
Family MAM domain 0.00072
Further Details:      
 
Domain Number 2 Region: 963-1127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-32
Family MAM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 63-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-31
Family MAM domain 0.0062
Further Details:      
 
Domain Number 4 Region: 804-961
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family MAM domain 0.0014
Further Details:      
 
Domain Number 5 Region: 271-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-16
Family MAM domain 0.008
Further Details:      
 
Domain Number 6 Region: 490-635
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000038
Family MAM domain 0.014
Further Details:      
 
Domain Number 7 Region: 228-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000126
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000014735
Domain Number - Region: 456-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000115
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014735   Gene: ENSOGAG00000016460   Transcript: ENSOGAT00000016469
Sequence length 1210
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:1233887:1241733:-1 gene:ENSOGAG00000016460 transcript:ENSOGAT00000016469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLGYLLPSLLLLIAGALGWAWVPSHCRPPSEAVCNFLCDCSSCSDEEQCGHHGASPAL
GTPFSCDFEQDPCGWQDISTSGYSWIRDRAGATLEGPGPHSDHTLGTDLGWHMAVGTHRG
KEVSTAVLRSPTLREAAPTCELRLWYHVASGDVAELSLQLTHNTETLTLWWSSGPWGPGW
QELAVTIGRIRGDFRVTFSATRNATHRGTVGLDDIEFWGCGLPTPQASCPPGHHHCQNKA
CIEPHQLCDGEDSCGDLSDEDPLTCGHHMVTNFETGLGPWNHLEGWVRNHSNASPEHPAW
PHRDHSQNSVRGSFLVSLAEPSRPAALFSPKLQASGPYNCSLVFYHYLHGSEASCLRLFL
QTLLPSSSPAPVLLQSRCGELGAAWVRDRVDIQSAHPFQILLAAQTGPGGVVGLDDLILS
NHCQLVPELAALQMLPPTPWAPAPESPPSGPWFQNVCSPGHLSCGDLCVPPEQLCDFQQQ
CTGAEDEQECGTTDFESPTAGGWEDASVGRLQWQLSAQRAATGHFLSLQKAWGQLRPEAR
VLSPALGPSGPRCELHLAYYFLSQPRGFLALVVVDGSSRELVWQAPSSSTGGWKVDKTLL
GARRRPFRLEFIGLLDLDGPGQQGAGVDNVTLRNCSPTETTERDREVSCNFERDTCSWYT
GHFTDAHWHRVQSHGPGYDHTTGRGHFMLLDPTEPPARDHGAYLLSQPQVPVAPIECLSF
WYHLYGPQIGTLRLLLRREGEEDTPLWSRSGTHGNRWHEAWATLHHQPHFHTQYQLLFEG
LRDGYHGTMALDDVALRPDPCWAPKHCSFEDSGCGFFTGDQGLWKCQTNASGQAAWGPPT
DHTTETAQGHYMVVDMSPNALPQGHVATLTSEEYRPLAQSACLTFWYHLSPRNPGTLRVH
MEQSGRRQVLSISAQGGAVWRLGSVGIQAGQAWRVVFEAVAAGVQPSYVALDDLFLQDGA
CPQPGSCDFETGLCGWSHLAWPGLSGYSWDWSSGTTPSRYPHPSVDHTLGTEAGHFAFFE
TGVLGPGGQVAWLRSEPLPATQASCLRFWYHMGFPEHFYKGELRVLLASTQGQLAVWGQG
GHRRHQWLEAQVEVASTEEFQIVFEATLSGQPALGPIALDDVEYQAGHHCQVPTPSQGHA
AMPGSVPAAVSGALLLFMLLVLLGLGGWLWLQKTGGCPFWSNREPVTSGFDNILFNADHV
TLPASVTNDP
Download sequence
Identical sequences H0XFF1
ENSOGAP00000014735 ENSOGAP00000014735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]