SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014766 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014766
Domain Number 1 Region: 318-423,545-661
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.83e-56
Family Phosphate binding protein-like 0.0000000402
Further Details:      
 
Domain Number 2 Region: 3-243
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.79e-22
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000014766
Domain Number - Region: 486-518
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0392
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014766   Gene: ENSOGAG00000016495   Transcript: ENSOGAT00000016503
Sequence length 1351
Comment pep:known_by_projection scaffold:OtoGar3:GL873643.1:2192541:2383997:-1 gene:ENSOGAG00000016495 transcript:ENSOGAT00000016503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGW
ELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWI
VPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEP
KSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKWERVG
KWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQ
KRIVTENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGM
IGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSAD
VWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNS
VPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDF
SPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLN
YMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWL
TGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHCFMGVCSGK
PGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMANLSGVNGS
PQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERTFGNLQLKD
SNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSISKKPLDIGLPSSKHSQLSD
LYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNSAKRRKQQYKDSLKKRPASAK
SRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKE
RSDDFKRDSVSGGGPCTNRSHLKHGAGDKHSVVGGVPAPWEKNLTNVEWEDRAGGNFCRS
CPSKLHNYSPAAATPGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAPGAATSN
ASTAKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSP
YAHMFEMPAGESTFANNKASVPTAGHHHHNNPGGSGGYMLSKSLYPDRVTQNPFIPTFGD
DQCLLHGSKSYFFRQPTVAGASKARPDFRALVTNKPVVSALHGAVPGRFQKDICIGNQSN
PCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
Download sequence
Identical sequences H0XFH5
ENSOGAP00000014766 ENSOGAP00000014766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]