SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014816 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014816
Domain Number 1 Region: 39-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.8e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014816   Gene: ENSOGAG00000016551   Transcript: ENSOGAT00000016559
Sequence length 183
Comment pep:known_by_projection scaffold:OtoGar3:GL873729.1:1418726:1422876:-1 gene:ENSOGAG00000016551 transcript:ENSOGAT00000016559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGFFGEPDAFPMFATNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFA
ELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKPGKDPVVGAGGGG
GGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPATDGA
GPR
Download sequence
Identical sequences H0XFL9
ENSOGAP00000014816 ENSOGAP00000014816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]