SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014817 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014817
Domain Number 1 Region: 150-274
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000706
Family 28-residue LRR 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014817   Gene: ENSOGAG00000016552   Transcript: ENSOGAT00000016560
Sequence length 428
Comment pep:known_by_projection scaffold:OtoGar3:GL873585.1:1096980:1115120:1 gene:ENSOGAG00000016552 transcript:ENSOGAT00000016560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYLNSESPLDPGPIYVRENGQLHMVDLALEGVRSGLQKPKPFRLFPKGFSVELCMNRE
EDTAHKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDNVDHIDSLIGFPEQIAEKLFS
AAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDL
SCCKLGDEHELLEHLTNEALSSVTQLHLKDNCLSDAGVRKMTAPVRVMKRGLENLTLLDL
SCNPEITDAGIGYLFSFRKLNCLDISGTGLKDVKAVKHKLQTHIGLVHSKVPLKEFDHSN
CKTEGWADQIVLQWERVTAEATKLRENSQPRTAARHFYGKRAPAEAPVTCPLADPHMNSS
EKLQFYREKAPDCHGPLLKCEAVSSQESKKSKKRAFEESEKEQNNSSPSSKQKYVCLAVE
DWDLLNSY
Download sequence
Identical sequences H0XFM0
XP_003793155.1.62490 ENSOGAP00000014817 ENSOGAP00000014817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]